(data stored in ACNUC7421 zone)

EMBL: CP001700.PE130

CP001700.PE130       Location/Qualifiers
FT   CDS             133375..135060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0130"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: aau:AAur_1455 putative lipoprotein precursor LplA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69085"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE6"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU69085.1"
FT                   /translation="MPFTSTAQQISRRTVLRTTGAAAVAAVAVPALAACGGSKTSSGAA
FT                   QSNVDKKLMAWPTYTPAAGLHPDMPGTAAGVQDTFLRYPSNLIQSVPAKPGDGSKVRAL
FT                   IVTYGTQPKGPDQNQLWKAVNDAVGVDLELTMVTDADWQTKLGAMMAASDLPDIIMLGL
FT                   YQLPNEAQFLQAKCEPLGQYLAGDAGAKAYPNLAAIPPYSWDSVGRVGGDFYGIPIHRP
FT                   RLGNSFFADSDLFQQAGIWNPKPGGLSKAELTAGLMKLNTQGHFALGTNKVASFGYLTH
FT                   SGVHGTPNLWSLANGQFTTAYGTDSMKQSLATMADWYGKGLYDPAALTVSSTQCKTDFQ
FT                   NGTYVTTTDGFGGFGGYATAVNEKWKVDFVRPFDAGTGAKPTPWLTPGYFGYTVLKKTT
FT                   PERAKMLLGVLNFLAAPFGSKEWELINYGLEGVHFNRGADGGPSAPTALGKIENSVNVP
FT                   VKYVMAAPLVNYLAGEPEAAKRCYQAQVDIVPIGVTDPSLGVQSATRNKQWPTLLQQIQ
FT                   DGMNQIITGKAQLSSWDDVIKKWKSSGGDQIAAELGAEYAKTHG"
     MPFTSTAQQI SRRTVLRTTG AAAVAAVAVP ALAACGGSKT SSGAAQSNVD KKLMAWPTYT        60
     PAAGLHPDMP GTAAGVQDTF LRYPSNLIQS VPAKPGDGSK VRALIVTYGT QPKGPDQNQL       120
     WKAVNDAVGV DLELTMVTDA DWQTKLGAMM AASDLPDIIM LGLYQLPNEA QFLQAKCEPL       180
     GQYLAGDAGA KAYPNLAAIP PYSWDSVGRV GGDFYGIPIH RPRLGNSFFA DSDLFQQAGI       240
     WNPKPGGLSK AELTAGLMKL NTQGHFALGT NKVASFGYLT HSGVHGTPNL WSLANGQFTT       300
     AYGTDSMKQS LATMADWYGK GLYDPAALTV SSTQCKTDFQ NGTYVTTTDG FGGFGGYATA       360
     VNEKWKVDFV RPFDAGTGAK PTPWLTPGYF GYTVLKKTTP ERAKMLLGVL NFLAAPFGSK       420
     EWELINYGLE GVHFNRGADG GPSAPTALGK IENSVNVPVK YVMAAPLVNY LAGEPEAAKR       480
     CYQAQVDIVP IGVTDPSLGV QSATRNKQWP TLLQQIQDGM NQIITGKAQL SSWDDVIKKW       540
     KSSGGDQIAA ELGAEYAKTH G                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page