(data stored in ACNUC7421 zone)

EMBL: CP001700.PE131

CP001700.PE131       Location/Qualifiers
FT   CDS             135108..136808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_5337 heparinase II/III family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69086"
FT                   /db_xref="GOA:C7QHE7"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69086.1"
FT                   /translation="MSYLAALEDEVRDVVARAAGSAAPELTYTLYRQFGDTGHRFSYEH
FT                   PYFERRGRLVAAGAAAIFDLRTDSAVSPEVLAVLADELWRICDEHTWALPAHEQYARDG
FT                   DMRRNVDLFAAETAHTVADLIERFGKQLPEDVIMRCREELLDRVFIPFADDQRPMAFEK
FT                   MTNNWLAVVAGGVGMAALAFFPDDAKRLAMILKRAQKSLRRFIEYYPADGGCSEGMDYW
FT                   VYGFGYFAYFAEAWRERGGPDLLLDTKIREIAAFPARVGFGDGRFPSFSDGSETATIPT
FT                   GLMARLVERLGVPVPRIETVPTFASDFCHRWPHLSKNIEWTTERVLNRAASPGVSYLPD
FT                   LAWVVDCGGEAEFAAKGGHNDEFHNHLDVGQFILRAHSETFLADLGAGEYTADYFGTKR
FT                   YQHVHTAAEGHSLPVIDGRGQLPGAQHAAKVERFAETGQGAILTLDMTSAYEVPGLLAL
FT                   GRRFTWQRHGSLVVVDRVETDRPMPFEELYISRIRPVLEADRVVWEGEAARCVLTWQET
FT                   LAMTPELETIETTGHRGELESVFRVRLRCMIEAGASRLESVFTVERKER"
     MSYLAALEDE VRDVVARAAG SAAPELTYTL YRQFGDTGHR FSYEHPYFER RGRLVAAGAA        60
     AIFDLRTDSA VSPEVLAVLA DELWRICDEH TWALPAHEQY ARDGDMRRNV DLFAAETAHT       120
     VADLIERFGK QLPEDVIMRC REELLDRVFI PFADDQRPMA FEKMTNNWLA VVAGGVGMAA       180
     LAFFPDDAKR LAMILKRAQK SLRRFIEYYP ADGGCSEGMD YWVYGFGYFA YFAEAWRERG       240
     GPDLLLDTKI REIAAFPARV GFGDGRFPSF SDGSETATIP TGLMARLVER LGVPVPRIET       300
     VPTFASDFCH RWPHLSKNIE WTTERVLNRA ASPGVSYLPD LAWVVDCGGE AEFAAKGGHN       360
     DEFHNHLDVG QFILRAHSET FLADLGAGEY TADYFGTKRY QHVHTAAEGH SLPVIDGRGQ       420
     LPGAQHAAKV ERFAETGQGA ILTLDMTSAY EVPGLLALGR RFTWQRHGSL VVVDRVETDR       480
     PMPFEELYIS RIRPVLEADR VVWEGEAARC VLTWQETLAM TPELETIETT GHRGELESVF       540
     RVRLRCMIEA GASRLESVFT VERKER                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page