(data stored in ACNUC7421 zone)

EMBL: CP001700.PE132

CP001700.PE132       Location/Qualifiers
FT   CDS             136808..138706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_2106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69087"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE8"
FT                   /inference="similar to AA sequence:KEGG:SAV_2106"
FT                   /protein_id="ACU69087.1"
FT                   /translation="MAGALDVPEDRRASPYTGWTREHWLAQADHLLDSVKPFASPSSAR
FT                   FELPGRPSVSGFDSDALEGFARTFLLAAWRIVADQGRGPVAEDLIARYSSGLAAGADAA
FT                   HPEAWPRIPQGRPGQPMVEAASIALGLHYTREWLWDKLDTRAQGLVADWLGEFVGNPTW
FT                   PNNWMLFQTVTEEFLSSIGAEYEESEILRGLDATEEWYVGDGWYTDGAGRNFDYYIGWA
FT                   MHLYPLVWTQMAEGGARNDRALAAREVYRDRLRQFLERYFDFFGADGAPIHQGRSLTYR
FT                   FAAAAPIWVGEMFDCSPYGAGLSRRAASGVMKHFAEHGAPDERGLLTLGWHEPFLPMVQ
FT                   NYSGPASPYWASKGFIGLMLPADHRVWTAPESPLPVEVADFETAIGPVGWSLSGTKRDG
FT                   VVRLLNHGSDKARHHTTPLAEYTDAFYSPLAFSTVTAPDTEAEAWAKRVGNHVALIAPD
FT                   GRVTSRAVIEPIGAAAEWGASRHVPGFEEEPGGTVRGVEGAEIETQTFVKEGAEIRVHR
FT                   VTAPAGWTVREGGYPVAGPEQVLRGENEKLPGAFAINDLGVMSRIESLGGWTSAGVESE
FT                   LGANALGAFSGTPYLMAEHPGGTVFYRSKVMVYRLPDEGVDEGADESVDEGGEVAE"
     MAGALDVPED RRASPYTGWT REHWLAQADH LLDSVKPFAS PSSARFELPG RPSVSGFDSD        60
     ALEGFARTFL LAAWRIVADQ GRGPVAEDLI ARYSSGLAAG ADAAHPEAWP RIPQGRPGQP       120
     MVEAASIALG LHYTREWLWD KLDTRAQGLV ADWLGEFVGN PTWPNNWMLF QTVTEEFLSS       180
     IGAEYEESEI LRGLDATEEW YVGDGWYTDG AGRNFDYYIG WAMHLYPLVW TQMAEGGARN       240
     DRALAAREVY RDRLRQFLER YFDFFGADGA PIHQGRSLTY RFAAAAPIWV GEMFDCSPYG       300
     AGLSRRAASG VMKHFAEHGA PDERGLLTLG WHEPFLPMVQ NYSGPASPYW ASKGFIGLML       360
     PADHRVWTAP ESPLPVEVAD FETAIGPVGW SLSGTKRDGV VRLLNHGSDK ARHHTTPLAE       420
     YTDAFYSPLA FSTVTAPDTE AEAWAKRVGN HVALIAPDGR VTSRAVIEPI GAAAEWGASR       480
     HVPGFEEEPG GTVRGVEGAE IETQTFVKEG AEIRVHRVTA PAGWTVREGG YPVAGPEQVL       540
     RGENEKLPGA FAINDLGVMS RIESLGGWTS AGVESELGAN ALGAFSGTPY LMAEHPGGTV       600
     FYRSKVMVYR LPDEGVDEGA DESVDEGGEV AE                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page