(data stored in ACNUC7421 zone)

EMBL: CP001700.PE133

CP001700.PE133       Location/Qualifiers
FT   CDS             138703..139476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0133"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sma:SAV_5310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69088"
FT                   /db_xref="GOA:C7QHE9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE9"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACU69088.1"
FT                   /translation="MSWPLAFSTLGCSGLPLADVVELARSTGWLGLELRAADDEPVHVG
FT                   LSPEERVAARALLESGGVTVLAVASYVKVARGEIGDDECVADALAHADLARDLGAPFVR
FT                   VFPGAEEPGADADARAVRRLNAIAERLPEGVAVLLETHDSHPQGVDIARVLSQVSGDVG
FT                   TIWDVMHPWRTGEPISVTKDVLAPYLRHVQVKDVLSPTERTPLPLGDGTIPLAEFYAAL
FT                   RELGYQGWMSLEWESKWHPEAVPLADALKVKPDFA"
     MSWPLAFSTL GCSGLPLADV VELARSTGWL GLELRAADDE PVHVGLSPEE RVAARALLES        60
     GGVTVLAVAS YVKVARGEIG DDECVADALA HADLARDLGA PFVRVFPGAE EPGADADARA       120
     VRRLNAIAER LPEGVAVLLE THDSHPQGVD IARVLSQVSG DVGTIWDVMH PWRTGEPISV       180
     TKDVLAPYLR HVQVKDVLSP TERTPLPLGD GTIPLAEFYA ALRELGYQGW MSLEWESKWH       240
     PEAVPLADAL KVKPDFA                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page