(data stored in ACNUC7421 zone)

EMBL: CP001700.PE134

CP001700.PE134       Location/Qualifiers
FT   CDS             complement(139484..140566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0134"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: rsa:RSal33209_0109 LacI family transcription
FT                   regulator; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69089"
FT                   /db_xref="GOA:C7QHF0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF0"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACU69089.1"
FT                   /translation="MPRRPEADRDSTTPRAATIRDVASRAGVSVATVSRVLTGNYPVAS
FT                   ATRTKVLRAVRELDYVVNAHARALAGNRSKMIAVLLSNLTSPFYNRVASGVEQQAMAED
FT                   RLCMVSTTGGDPEREVKLVETLREQNVDAVVLVGGVVDSPEYRDHMARLARLLDSAGSR
FT                   LVICGRPSPGENLPVTVVEYDNAGGAFAATSHLLSQGHRRILFIGGDEANTTTRDRLDG
FT                   YRRAIQAYGIEADPALVIVGNQLPPFAYAELKKRLAAGPPDFTAVFAWDDHIAARTLVA
FT                   LRESGVSVPDQVSVIGYNDEQEAQDLYPALTTVSIPHMELGREAVRLALHRDEAAAPNQ
FT                   HVVLGTHIVMRDSVRPLINR"
     MPRRPEADRD STTPRAATIR DVASRAGVSV ATVSRVLTGN YPVASATRTK VLRAVRELDY        60
     VVNAHARALA GNRSKMIAVL LSNLTSPFYN RVASGVEQQA MAEDRLCMVS TTGGDPEREV       120
     KLVETLREQN VDAVVLVGGV VDSPEYRDHM ARLARLLDSA GSRLVICGRP SPGENLPVTV       180
     VEYDNAGGAF AATSHLLSQG HRRILFIGGD EANTTTRDRL DGYRRAIQAY GIEADPALVI       240
     VGNQLPPFAY AELKKRLAAG PPDFTAVFAW DDHIAARTLV ALRESGVSVP DQVSVIGYND       300
     EQEAQDLYPA LTTVSIPHME LGREAVRLAL HRDEAAAPNQ HVVLGTHIVM RDSVRPLINR       360
//

If you have problems or comments...

PBIL Back to PBIL home page