(data stored in ACNUC7421 zone)

EMBL: CP001700.PE135

CP001700.PE135       Location/Qualifiers
FT   CDS             complement(140607..143765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0135"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: sco:SCO6193 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69090"
FT                   /db_xref="GOA:C7QHF1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF1"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACU69090.1"
FT                   /translation="MIGHGELVADLTARAADAVPTVLTAPPGRGKSALLDAVAEPWIAR
FT                   EDHVVWLTAAPTDRDVPFAALTDLLTEAPDLPEPWLAALKQALRRIPGTPDRVAIRLAA
FT                   RACLDAAIPPDKGVLLLADDLQWWDADSLDVLAHLARHGIPVVAATRPGGPVDLLGRDA
FT                   QEVPVPALTAEQTATLLQERGIGFRIAARVHTAAGGNARLTVEIARGFDATSGALDAVT
FT                   TPAAARRCIRGWIDELPTPDNVWRTLLIAAIAADPAIPTLRRTAGPATLEALACAEQAG
FT                   LITVDVHGTVTFPATAVRDTVLADASQETLRTAHLLLAETTTDPTARLWHRATAARDRP
FT                   DLEVASELAIAARAVRRRGDPGRAAELWLLAAEMMPARETMAETTDASNGSLAPLPAPV
FT                   SGTADRTQHADQQPVARDASAARQHATHAQPSSGPTATTGSLSAPDASTTRHQAATAQP
FT                   ADTPPQTADFPTRATRQPAATSQPISDPTPATSFFTALDASDTRQPAASSAPAGRPSTT
FT                   AASTDQPPRPPASRTTPRPTAVAALLLAAATDAAAAGRPHLARTAVARLDRTESDHAAR
FT                   ARARLAVVDAAGQAVGGLDGILGRALADAEAAADPALLSAVHLRVAWHAHLALGDNRRA
FT                   HDAARAAVRAAELSQDAESRAAALVMLARIEQLLGESSYPRVLRRALALSPEPPGALLN
FT                   SPRWLSVRFALFADQLDEARHHLSQLTSHAERSGSHADRALLLRGAVEIDARAGHGAAA
FT                   IRSARRLEELPGADRASPGPVWFTAALAQTAGGTLEEALRLADRGTAASAQEQDQIFLT
FT                   RCLALSGGIRLLLRDTAAAADDLNRVRTLVAEQGIADPAAVRFHADLAEVLVSLGQPDE
FT                   AAVIVTETRRAAEELRRRGVLASLDRADAVIKASQGDHARAEALLHRADHTFHTLGLPL
FT                   ERGRVLLTRAIIDKRRRRAASARRFHDQATAIFQRAQAPLWEPAEVVTETPGPAHGPGQ
FT                   GPAPDLTAAEQRIVALVTEGLPNREIAANLFLSVKTVESVLTGVYRKLGVRSRTQLAVL
FT                   LRDD"
     MIGHGELVAD LTARAADAVP TVLTAPPGRG KSALLDAVAE PWIAREDHVV WLTAAPTDRD        60
     VPFAALTDLL TEAPDLPEPW LAALKQALRR IPGTPDRVAI RLAARACLDA AIPPDKGVLL       120
     LADDLQWWDA DSLDVLAHLA RHGIPVVAAT RPGGPVDLLG RDAQEVPVPA LTAEQTATLL       180
     QERGIGFRIA ARVHTAAGGN ARLTVEIARG FDATSGALDA VTTPAAARRC IRGWIDELPT       240
     PDNVWRTLLI AAIAADPAIP TLRRTAGPAT LEALACAEQA GLITVDVHGT VTFPATAVRD       300
     TVLADASQET LRTAHLLLAE TTTDPTARLW HRATAARDRP DLEVASELAI AARAVRRRGD       360
     PGRAAELWLL AAEMMPARET MAETTDASNG SLAPLPAPVS GTADRTQHAD QQPVARDASA       420
     ARQHATHAQP SSGPTATTGS LSAPDASTTR HQAATAQPAD TPPQTADFPT RATRQPAATS       480
     QPISDPTPAT SFFTALDASD TRQPAASSAP AGRPSTTAAS TDQPPRPPAS RTTPRPTAVA       540
     ALLLAAATDA AAAGRPHLAR TAVARLDRTE SDHAARARAR LAVVDAAGQA VGGLDGILGR       600
     ALADAEAAAD PALLSAVHLR VAWHAHLALG DNRRAHDAAR AAVRAAELSQ DAESRAAALV       660
     MLARIEQLLG ESSYPRVLRR ALALSPEPPG ALLNSPRWLS VRFALFADQL DEARHHLSQL       720
     TSHAERSGSH ADRALLLRGA VEIDARAGHG AAAIRSARRL EELPGADRAS PGPVWFTAAL       780
     AQTAGGTLEE ALRLADRGTA ASAQEQDQIF LTRCLALSGG IRLLLRDTAA AADDLNRVRT       840
     LVAEQGIADP AAVRFHADLA EVLVSLGQPD EAAVIVTETR RAAEELRRRG VLASLDRADA       900
     VIKASQGDHA RAEALLHRAD HTFHTLGLPL ERGRVLLTRA IIDKRRRRAA SARRFHDQAT       960
     AIFQRAQAPL WEPAEVVTET PGPAHGPGQG PAPDLTAAEQ RIVALVTEGL PNREIAANLF      1020
     LSVKTVESVL TGVYRKLGVR SRTQLAVLLR DD                                    1052
//

If you have problems or comments...

PBIL Back to PBIL home page