(data stored in ACNUC7421 zone)

EMBL: CP001700.PE136

CP001700.PE136       Location/Qualifiers
FT   CDS             144022..145890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0136"
FT                   /product="Ig family protein"
FT                   /note="PFAM: Ig family protein; KEGG: sma:SAV_5630 neutral
FT                   zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69091"
FT                   /db_xref="GOA:C7QHF2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF2"
FT                   /inference="protein motif:PFAM:PF05345"
FT                   /protein_id="ACU69091.1"
FT                   /translation="MKNTNTRRRAAAAGAAVATMAAGFGLLAATAQTAQAWEINPASCK
FT                   HAPHSHKHGVQPTETQTLCDRINAAGHAAPTGSETLSYGGGVDGIGVNSGKNQVYLVFY
FT                   GSQWGTQTAGSNGVSSFSGDPKGAAPAAQKMFKDIGTGGETWSADLTQWCDGPNVAAGA
FT                   TSCPSNAAFVPYQSGGVLAGVWYDNSAASPAKASGHALGVEAVNAAAHFGNTTAASNRN
FT                   AYYVILSPTGTNPDDYENPSTGYCAWHDYNGDTTLTGGAVASSYGDIAFSNQPYNIDAG
FT                   QTCGTNFVNSGSAGTLDGYTMTLGHEWHEMMSDKNPAGGWTNNTGSSYNGQENSDECAW
FT                   LKPGTTGGAANVTLGSDTFAEQASWSNDTNGCAMSHQILTHNGGGAVTVTQPAAQTSTV
FT                   GSAVSLQIQASDSTSGQTLSYTATGLPQGVAINSASGLISGTPTTAGSSSVTVTVKDTT
FT                   GASGSATFGWTVNSTTGGGTVITNGGFENGSLSGWTTSGVTAATATGPHAGGYAAELGN
FT                   LNPSSTSTIAQTFTAGAGNSRLAFWYNVTCDDTVQYDWATATLKDNTTGTTKTVLAKTC
FT                   TNPTSGWKQVTAAVTAGDSYTLTLSNHDDNYAGDPTYTLYDDVAVS"
     MKNTNTRRRA AAAGAAVATM AAGFGLLAAT AQTAQAWEIN PASCKHAPHS HKHGVQPTET        60
     QTLCDRINAA GHAAPTGSET LSYGGGVDGI GVNSGKNQVY LVFYGSQWGT QTAGSNGVSS       120
     FSGDPKGAAP AAQKMFKDIG TGGETWSADL TQWCDGPNVA AGATSCPSNA AFVPYQSGGV       180
     LAGVWYDNSA ASPAKASGHA LGVEAVNAAA HFGNTTAASN RNAYYVILSP TGTNPDDYEN       240
     PSTGYCAWHD YNGDTTLTGG AVASSYGDIA FSNQPYNIDA GQTCGTNFVN SGSAGTLDGY       300
     TMTLGHEWHE MMSDKNPAGG WTNNTGSSYN GQENSDECAW LKPGTTGGAA NVTLGSDTFA       360
     EQASWSNDTN GCAMSHQILT HNGGGAVTVT QPAAQTSTVG SAVSLQIQAS DSTSGQTLSY       420
     TATGLPQGVA INSASGLISG TPTTAGSSSV TVTVKDTTGA SGSATFGWTV NSTTGGGTVI       480
     TNGGFENGSL SGWTTSGVTA ATATGPHAGG YAAELGNLNP SSTSTIAQTF TAGAGNSRLA       540
     FWYNVTCDDT VQYDWATATL KDNTTGTTKT VLAKTCTNPT SGWKQVTAAV TAGDSYTLTL       600
     SNHDDNYAGD PTYTLYDDVA VS                                                622
//

If you have problems or comments...

PBIL Back to PBIL home page