(data stored in ACNUC7421 zone)

EMBL: CP001700.PE137

CP001700.PE137       Location/Qualifiers
FT   CDS             complement(145960..146790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0137"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: tfu:Tfu_1719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69092"
FT                   /db_xref="GOA:C7QHF3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF3"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACU69092.1"
FT                   /translation="MKLSLNQATVKRLTLAEAAEGCVRAGIPAIGLWRDRVQEIGIEAA
FT                   AKIVRASGLEVTSLCRGGFMTAASAADRAAALADNKQAVLEAAGVGTDVLILVVGGLPS
FT                   GSKDLPAARGAVAEGVADLVPFAAEHGVKLAIEPLHPMFCADRAVVSTLGQALDIAEAF
FT                   PAEQVGVVVDTYHVWWDPQLEASIARAGKGNRILSYQECDWVVPLPADMLLGRGHVGDG
FT                   HIDFARMRSLVTAAGWTGYAEVEIFNQEIWDADGDRTIATVRSRHEAVSAASGL"
     MKLSLNQATV KRLTLAEAAE GCVRAGIPAI GLWRDRVQEI GIEAAAKIVR ASGLEVTSLC        60
     RGGFMTAASA ADRAAALADN KQAVLEAAGV GTDVLILVVG GLPSGSKDLP AARGAVAEGV       120
     ADLVPFAAEH GVKLAIEPLH PMFCADRAVV STLGQALDIA EAFPAEQVGV VVDTYHVWWD       180
     PQLEASIARA GKGNRILSYQ ECDWVVPLPA DMLLGRGHVG DGHIDFARMR SLVTAAGWTG       240
     YAEVEIFNQE IWDADGDRTI ATVRSRHEAV SAASGL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page