(data stored in ACNUC7421 zone)

EMBL: CP001700.PE139

CP001700.PE139       Location/Qualifiers
FT   CDS             complement(147112..148188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO2751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69094"
FT                   /db_xref="InterPro:IPR009334"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF5"
FT                   /inference="similar to AA sequence:KEGG:SCO2751"
FT                   /protein_id="ACU69094.1"
FT                   /translation="MAGFTSRVVYAAAHVVADPEADNRAGKPAVLDWDATLRFREHLWS
FT                   LGFGIADAMDTAQRGMGLDWSATQELIRRSGAAAKAVDAGNVPTLLACGAGTDQLSAGA
FT                   HSLPDIRAAYEEQLDVVEAAGARVILMASRALAASARSAEDYLTTYRALLDQAANPVIL
FT                   HWLGDMFDPALAGYWGSADIPTAMATVLELINANPQKVDGIKISLLNADHELELRRRLP
FT                   AGVRLYTGDDFNYPQLIKGDTTGHSDALLGIFDGIARPAAQALQALDRGDLQTYDRLMN
FT                   PTVALSRHIFEKPTFHYKTGLVFLAYLNGHQAHFRMVGALETARDTTHLTKLLHLAEAA
FT                   GVIDDPELAAQRFAAVVA"
     MAGFTSRVVY AAAHVVADPE ADNRAGKPAV LDWDATLRFR EHLWSLGFGI ADAMDTAQRG        60
     MGLDWSATQE LIRRSGAAAK AVDAGNVPTL LACGAGTDQL SAGAHSLPDI RAAYEEQLDV       120
     VEAAGARVIL MASRALAASA RSAEDYLTTY RALLDQAANP VILHWLGDMF DPALAGYWGS       180
     ADIPTAMATV LELINANPQK VDGIKISLLN ADHELELRRR LPAGVRLYTG DDFNYPQLIK       240
     GDTTGHSDAL LGIFDGIARP AAQALQALDR GDLQTYDRLM NPTVALSRHI FEKPTFHYKT       300
     GLVFLAYLNG HQAHFRMVGA LETARDTTHL TKLLHLAEAA GVIDDPELAA QRFAAVVA         358
//

If you have problems or comments...

PBIL Back to PBIL home page