(data stored in ACNUC7421 zone)

EMBL: CP001700.PE14

CP001700.PE14        Location/Qualifiers
FT   CDS             16485..16967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0014"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: tfu:Tfu_2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68969"
FT                   /db_xref="GOA:C7QFN0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU68969.1"
FT                   /translation="MDVWSKEFAGRPECLAEARRFTYAVLGRGDGAHIAALVADELAGN
FT                   AIRHTASGRPGGEFILRLARFGNRCRVRVDDQGGPTTPEVCAATDFEEAGRGLTIVASL
FT                   SAQWGVEGDEHARSVWAEITFEEIPGISGPDGPAVDLPPQARARRKVGMTTEDWTR"
     MDVWSKEFAG RPECLAEARR FTYAVLGRGD GAHIAALVAD ELAGNAIRHT ASGRPGGEFI        60
     LRLARFGNRC RVRVDDQGGP TTPEVCAATD FEEAGRGLTI VASLSAQWGV EGDEHARSVW       120
     AEITFEEIPG ISGPDGPAVD LPPQARARRK VGMTTEDWTR                             160
//

If you have problems or comments...

PBIL Back to PBIL home page