(data stored in ACNUC7421 zone)

EMBL: CP001700.PE140

CP001700.PE140       Location/Qualifiers
FT   CDS             complement(148197..149357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0140"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: sgr:SGR_4813 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69095"
FT                   /db_xref="GOA:C7QHF6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF6"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACU69095.1"
FT                   /translation="MTRETVGIAMNGVTGRMGYRQHLLRSILAIRDQGGLALPDGRTVW
FT                   PEPILVGRNAEKIEALATRHGLDKWTTSLDEALADPSVTVYFDAQVTQARVPAITRAIE
FT                   AGKHIYTEKPTAETLDDAISLARIADAAGIKHGVVQDKLFLPGLLKLKRLVDSSFFGRI
FT                   LSVRGEFGYWVFEGDWQPAQRPSWNYRAEDGGGIILDMFPHWRYVLDHIIAPVRSVYAE
FT                   ARTDIPTRWDEQGREYKATADDAAYALFELEGGIVASLNSSWTTRVNREELVEFQIDGT
FT                   HGSAVAGLRNCKAQHRAATPKPVWNPDIPATEDFLAQWQEVPDNAVMDNGFKVQWEMFL
FT                   AHLVADAPYSHDLWAGARGVQLAELGAQSWREGRKVAVPELDRTGK"
     MTRETVGIAM NGVTGRMGYR QHLLRSILAI RDQGGLALPD GRTVWPEPIL VGRNAEKIEA        60
     LATRHGLDKW TTSLDEALAD PSVTVYFDAQ VTQARVPAIT RAIEAGKHIY TEKPTAETLD       120
     DAISLARIAD AAGIKHGVVQ DKLFLPGLLK LKRLVDSSFF GRILSVRGEF GYWVFEGDWQ       180
     PAQRPSWNYR AEDGGGIILD MFPHWRYVLD HIIAPVRSVY AEARTDIPTR WDEQGREYKA       240
     TADDAAYALF ELEGGIVASL NSSWTTRVNR EELVEFQIDG THGSAVAGLR NCKAQHRAAT       300
     PKPVWNPDIP ATEDFLAQWQ EVPDNAVMDN GFKVQWEMFL AHLVADAPYS HDLWAGARGV       360
     QLAELGAQSW REGRKVAVPE LDRTGK                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page