(data stored in ACNUC7421 zone)

EMBL: CP001700.PE141

CP001700.PE141       Location/Qualifiers
FT   CDS             149451..150509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0141"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: tfu:Tfu_1710 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69096"
FT                   /db_xref="GOA:C7QHF7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF7"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACU69096.1"
FT                   /translation="MSTQRSTPSPAPRRGGATLQQVADAAGVSLATASRVLNGSTRTVN
FT                   PELSEHVREVATRLRYVSHGPAQALARATTSLVGLLVHDVNDPYFSAVAAGAMRVARER
FT                   DLLVMVANTYRDPELELDYITRLGAQRARAILVAGSPPVDPALAKPLRERLLDYQQGGG
FT                   RVVSIGDQGPDIDAVLPANVEGARAAALHLTALGHREIGMVAGPRGLVTIADRSEGFRS
FT                   GLMDSDGDPVGHEIEGAFTRDGGYDATQRLLAAHPDVTAVFVMADVMAIGALAALRDAG
FT                   RRVPDDVSLVGFDDLPICADLMPALTTVRVDTEGMGEQAMRMVVSEVQDEGRAVVHSAT
FT                   ELIVRGSTGPAA"
     MSTQRSTPSP APRRGGATLQ QVADAAGVSL ATASRVLNGS TRTVNPELSE HVREVATRLR        60
     YVSHGPAQAL ARATTSLVGL LVHDVNDPYF SAVAAGAMRV ARERDLLVMV ANTYRDPELE       120
     LDYITRLGAQ RARAILVAGS PPVDPALAKP LRERLLDYQQ GGGRVVSIGD QGPDIDAVLP       180
     ANVEGARAAA LHLTALGHRE IGMVAGPRGL VTIADRSEGF RSGLMDSDGD PVGHEIEGAF       240
     TRDGGYDATQ RLLAAHPDVT AVFVMADVMA IGALAALRDA GRRVPDDVSL VGFDDLPICA       300
     DLMPALTTVR VDTEGMGEQA MRMVVSEVQD EGRAVVHSAT ELIVRGSTGP AA               352
//

If you have problems or comments...

PBIL Back to PBIL home page