(data stored in ACNUC7421 zone)

EMBL: CP001700.PE142

CP001700.PE142       Location/Qualifiers
FT   CDS             150596..151456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0142"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: sgr:SGR_4335 putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69097"
FT                   /db_xref="GOA:C7QHF8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF8"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACU69097.1"
FT                   /translation="MPVVLSAAFLHASWNAILKFVSDKLTASLLMTVSSGVLAAIGVFL
FT                   LPAPDRASWVLLLVSAALHVGYFLMLIKTFEIGDFNQVYPLARGLSPVVVAFFATALGD
FT                   PMSRHQTVGIAVVCGGLTTLVFSAGRPKRAQGKALFWAAMTGLSIATYTVTDGVAVRHS
FT                   KTAAGYTAWMMLAESTLMTAACVAIMTRRGRVSTAAGLLPTLRKLSRGDVLRGVIAGAL
FT                   SLFAYGLVLWAQTRGALAAVSALRETSVIFGAALGSVFLREPFGRYRIFAAVAIAGGIL
FT                   ILEAA"
     MPVVLSAAFL HASWNAILKF VSDKLTASLL MTVSSGVLAA IGVFLLPAPD RASWVLLLVS        60
     AALHVGYFLM LIKTFEIGDF NQVYPLARGL SPVVVAFFAT ALGDPMSRHQ TVGIAVVCGG       120
     LTTLVFSAGR PKRAQGKALF WAAMTGLSIA TYTVTDGVAV RHSKTAAGYT AWMMLAESTL       180
     MTAACVAIMT RRGRVSTAAG LLPTLRKLSR GDVLRGVIAG ALSLFAYGLV LWAQTRGALA       240
     AVSALRETSV IFGAALGSVF LREPFGRYRI FAAVAIAGGI LILEAA                      286
//

If you have problems or comments...

PBIL Back to PBIL home page