(data stored in ACNUC7421 zone)

EMBL: CP001700.PE143

CP001700.PE143       Location/Qualifiers
FT   CDS             complement(151637..152257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0143"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: sco:SCO5749 two-component
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69098"
FT                   /db_xref="GOA:C7QHF9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69098.1"
FT                   /translation="MNDAHRASAPSDGDIKILLVDDRPENLLALESILGSLGHELVTAA
FT                   SGEQALRAVLREEFAVILLDVRMPGMDGFEVAAHIRLRERSRDTPIIFLTAAGDGPHQT
FT                   LRGYAAGAADYLTKPFDPWVLRAKVGVFAELHRKNRQLKEQAEMLRETAGVTPRMLDEL
FT                   SNRLGAIEGTLALLIDQSGREGPVGRLERRVVRMRAALDAVRV"
     MNDAHRASAP SDGDIKILLV DDRPENLLAL ESILGSLGHE LVTAASGEQA LRAVLREEFA        60
     VILLDVRMPG MDGFEVAAHI RLRERSRDTP IIFLTAAGDG PHQTLRGYAA GAADYLTKPF       120
     DPWVLRAKVG VFAELHRKNR QLKEQAEMLR ETAGVTPRML DELSNRLGAI EGTLALLIDQ       180
     SGREGPVGRL ERRVVRMRAA LDAVRV                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page