(data stored in ACNUC7421 zone)

EMBL: CP001700.PE144

CP001700.PE144       Location/Qualifiers
FT   CDS             complement(152254..155613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0144"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: sgr:SGR_1773 putative two-component system
FT                   sensor kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; response regulator receiver; GAF domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; response regulator receiver; histidine
FT                   kinase A domain protein; GAF domain protein; histidine
FT                   kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69099"
FT                   /db_xref="GOA:C7QHG0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG0"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACU69099.1"
FT                   /translation="MTLQSDARTDPELDRQLGAILEVAQAVARGDLSRKIALSGDIVDG
FT                   PVAELARTIDAMVGQLSGFASEVIRVARELGTEGRLGGQATVEHAEGIWRDITDSVNSA
FT                   ARNLTAQVRDIAGVTTAVAQGDLTQKITVEVAGEMLELKDTINTMVDQLSGFADEVTRV
FT                   SLEVGTEGRLGGQARVPGVAGTWKDLTDSVNSMADNLTTQVRNIAQVATAVASGDLTQS
FT                   ITVDARGEILELKTTLNKMVDRLGTFADEVTRVAREVGTEGKLGGQATVRGVAGTWKDL
FT                   TDNVNAMANNLTSQVRNIAQVTTAVANGDLSKRIDVEARGEILELKTTLNTMVDRLSAF
FT                   ASEVTRVAREVGTEGKLGGQATVEDVSGTWQRLTESVNELASNLTTQVRAIAEVATAVT
FT                   AGDLTRLITVEAKGEVADLKNNINQMIGNLRETTRRNDQQDWLNTNLARMSGLMQGQRD
FT                   LDAISALIMSELTPLVNAQYGAFYLARKESGTKVLNLIASYGVDRESPDVTSRFRLGQG
FT                   MVGQAAVERKPIMIQHAPVDYIRISSGLGSAPPSSVAVLPVLFENEVMAVIELASFHSF
FT                   DEVHRALMESLMEMVGVTVNTITANTRTEELLGESRRLADELKARTDELQMQQKELRRS
FT                   NAELEEKAELLARQNQDIEVKNSEIEQARQELEERANQLTMSSRYKSEFLANMSHELRT
FT                   PLNSLLILARLMSDNAEGNLTERQVEYAETIHGAGSDLLQLINDILDLSKIEAGRMDVQ
FT                   PARIAVSQLVDYVEATFRPQTEQKGLELRVRVAPSVPAHLFTDEQRLQQVLRNLLSNSV
FT                   KFTETGHVELVVDTVGDVVLGGPEDSNEVTLEPAVSFAVSDTGIGIVDDKIQTVFEAFQ
FT                   QEDGTTSRRYGGTGLGLSISREIAKLLGGGIRAESQRGRGSTFTLFLPHAVGPDGAAVF
FT                   GSTGSLGYGTSPGPTGAIAEPAPTLPMIPEQAPHPDLYLPSTDLHAAGSDITFDGEKIL
FT                   IVDDDIRNVFALTSVLEQHGCAVLNAENGRAGLEALERADDVALVLMDVMMPEMDGYAT
FT                   MAAIREIDRYKNLPIIALTAKAMRGDREKSIEAGASDYVTKPVDTPHLLTVMRGWLDAE
FT                   TGAQPAPGGPAQ"
     MTLQSDARTD PELDRQLGAI LEVAQAVARG DLSRKIALSG DIVDGPVAEL ARTIDAMVGQ        60
     LSGFASEVIR VARELGTEGR LGGQATVEHA EGIWRDITDS VNSAARNLTA QVRDIAGVTT       120
     AVAQGDLTQK ITVEVAGEML ELKDTINTMV DQLSGFADEV TRVSLEVGTE GRLGGQARVP       180
     GVAGTWKDLT DSVNSMADNL TTQVRNIAQV ATAVASGDLT QSITVDARGE ILELKTTLNK       240
     MVDRLGTFAD EVTRVAREVG TEGKLGGQAT VRGVAGTWKD LTDNVNAMAN NLTSQVRNIA       300
     QVTTAVANGD LSKRIDVEAR GEILELKTTL NTMVDRLSAF ASEVTRVARE VGTEGKLGGQ       360
     ATVEDVSGTW QRLTESVNEL ASNLTTQVRA IAEVATAVTA GDLTRLITVE AKGEVADLKN       420
     NINQMIGNLR ETTRRNDQQD WLNTNLARMS GLMQGQRDLD AISALIMSEL TPLVNAQYGA       480
     FYLARKESGT KVLNLIASYG VDRESPDVTS RFRLGQGMVG QAAVERKPIM IQHAPVDYIR       540
     ISSGLGSAPP SSVAVLPVLF ENEVMAVIEL ASFHSFDEVH RALMESLMEM VGVTVNTITA       600
     NTRTEELLGE SRRLADELKA RTDELQMQQK ELRRSNAELE EKAELLARQN QDIEVKNSEI       660
     EQARQELEER ANQLTMSSRY KSEFLANMSH ELRTPLNSLL ILARLMSDNA EGNLTERQVE       720
     YAETIHGAGS DLLQLINDIL DLSKIEAGRM DVQPARIAVS QLVDYVEATF RPQTEQKGLE       780
     LRVRVAPSVP AHLFTDEQRL QQVLRNLLSN SVKFTETGHV ELVVDTVGDV VLGGPEDSNE       840
     VTLEPAVSFA VSDTGIGIVD DKIQTVFEAF QQEDGTTSRR YGGTGLGLSI SREIAKLLGG       900
     GIRAESQRGR GSTFTLFLPH AVGPDGAAVF GSTGSLGYGT SPGPTGAIAE PAPTLPMIPE       960
     QAPHPDLYLP STDLHAAGSD ITFDGEKILI VDDDIRNVFA LTSVLEQHGC AVLNAENGRA      1020
     GLEALERADD VALVLMDVMM PEMDGYATMA AIREIDRYKN LPIIALTAKA MRGDREKSIE      1080
     AGASDYVTKP VDTPHLLTVM RGWLDAETGA QPAPGGPAQ                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page