(data stored in ACNUC7421 zone)

EMBL: CP001700.PE145

CP001700.PE145       Location/Qualifiers
FT   CDS             155821..157098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0145"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: sgr:SGR_1774
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69100"
FT                   /db_xref="GOA:C7QHG1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG1"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ACU69100.1"
FT                   /translation="MAPRTPRTPLPRDRPEEAVRLTLLSQAGELLAGTLDRRRLAALAS
FT                   QLIVPRLADWVALYPPAADHSIVSSSWSPEHLWHREERKLDALAAALADWHPPTGEDGH
FT                   VPGSGSGRWPVQVASPYGQALPIPLAARGVSLGTLVLGGPGKGGFAGATLPLLMELAGR
FT                   ISGALDNARQYAEQVEIVRGLQRSLLPPSLPTVDGLDIGVVYEAASNSDGVHVGGDFYD
FT                   VFPISRKVWGFAVGDVCGTGPEAAALTGLARHSLRLLAREGRSPVTVVERLNQAVLEEG
FT                   ELAGDAGRFITLLYGEVEPRPDGSAQLVLVCAGHPLPLVLRQDGSVRAAANPQPLLGVL
FT                   PDPTLYAEDVELGAGEVLLVYTDGASERRNGRQMLGDEGVAAALAGCSGMTAPGVVARV
FT                   RQAVADFGSSGTRDDLALLALRAYKG"
     MAPRTPRTPL PRDRPEEAVR LTLLSQAGEL LAGTLDRRRL AALASQLIVP RLADWVALYP        60
     PAADHSIVSS SWSPEHLWHR EERKLDALAA ALADWHPPTG EDGHVPGSGS GRWPVQVASP       120
     YGQALPIPLA ARGVSLGTLV LGGPGKGGFA GATLPLLMEL AGRISGALDN ARQYAEQVEI       180
     VRGLQRSLLP PSLPTVDGLD IGVVYEAASN SDGVHVGGDF YDVFPISRKV WGFAVGDVCG       240
     TGPEAAALTG LARHSLRLLA REGRSPVTVV ERLNQAVLEE GELAGDAGRF ITLLYGEVEP       300
     RPDGSAQLVL VCAGHPLPLV LRQDGSVRAA ANPQPLLGVL PDPTLYAEDV ELGAGEVLLV       360
     YTDGASERRN GRQMLGDEGV AAALAGCSGM TAPGVVARVR QAVADFGSSG TRDDLALLAL       420
     RAYKG                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page