(data stored in ACNUC7421 zone)

EMBL: CP001700.PE146

CP001700.PE146       Location/Qualifiers
FT   CDS             complement(157217..158200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69101"
FT                   /db_xref="GOA:C7QHG2"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69101.1"
FT                   /translation="MTELDTREDDWARGVFDRARTGRHEPHWAPDAAGAARLSKRRQTR
FT                   YRATGALAVMAVAGLSATAFTALGGNVFHARDTVSPGSSGPILWPGLDLTKYLDVHESY
FT                   MVAAGHQYEANRMPAVSLATTSTVLQRLDPGLKHVRTVSGHQDLDITPTPPGVTTMAVQ
FT                   ADGIWSPNGDLSTFPPASSNFSPVTTPFGYVSIATMGPHVAQDANMENKPCGLGTLVTS
FT                   TRIPAPTAWSPCVRSHQSDGSDILVTHAVNLPAGAVTVAARVFPDTSTVQVTASSVFGL
FT                   QEGPAAGSSTPATPAKFDAGPPLNPVPWTDDSLAQVLTGPDVKGLP"
     MTELDTREDD WARGVFDRAR TGRHEPHWAP DAAGAARLSK RRQTRYRATG ALAVMAVAGL        60
     SATAFTALGG NVFHARDTVS PGSSGPILWP GLDLTKYLDV HESYMVAAGH QYEANRMPAV       120
     SLATTSTVLQ RLDPGLKHVR TVSGHQDLDI TPTPPGVTTM AVQADGIWSP NGDLSTFPPA       180
     SSNFSPVTTP FGYVSIATMG PHVAQDANME NKPCGLGTLV TSTRIPAPTA WSPCVRSHQS       240
     DGSDILVTHA VNLPAGAVTV AARVFPDTST VQVTASSVFG LQEGPAAGSS TPATPAKFDA       300
     GPPLNPVPWT DDSLAQVLTG PDVKGLP                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page