(data stored in ACNUC7421 zone)

EMBL: CP001700.PE148

CP001700.PE148       Location/Qualifiers
FT   CDS             complement(158807..160081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0148"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   nca:Noca_4538 cyclopropane-fatty-acyl- phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69103"
FT                   /db_xref="GOA:C7QHG4"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG4"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ACU69103.1"
FT                   /translation="MTHPAPTPLIDTDRWPDLARVPDRPVRARIARRLFTHALKDVPVT
FT                   VVAPNGLALAGAGVPGGGGPVLRVRRPKEFLNRLGSDGLIGFGEAYQTGAWDTETGDEL
FT                   VALLTELASRLEDLVPKPLQRMRSLAAHHMPRDQDGDRHGARHNAHAHYDLSNDMFEAF
FT                   LDPSMTYSAALFDPVADADGPGDLHAAQLRKIDAMLDAAGVRKGTRLLEIGSGWGGLAI
FT                   KAAGERGATVLTVTLSEEQQELARRRIAAAGLAGRIEVRLADYREVAEEQPFDAVVSVE
FT                   MIEAVGRRYLPDYFQAIERNLARGGRVAVQAITMAHHRMLATQDSYSWIHKYVFPGGLI
FT                   PSIPELDFAAETAGLRLAARRDFGLDYARTLRAWRHRFEENWPKVAGHGFDEVFRRTWR
FT                   FYLAYCEAGFASGYLGVSQLTYTRP"
     MTHPAPTPLI DTDRWPDLAR VPDRPVRARI ARRLFTHALK DVPVTVVAPN GLALAGAGVP        60
     GGGGPVLRVR RPKEFLNRLG SDGLIGFGEA YQTGAWDTET GDELVALLTE LASRLEDLVP       120
     KPLQRMRSLA AHHMPRDQDG DRHGARHNAH AHYDLSNDMF EAFLDPSMTY SAALFDPVAD       180
     ADGPGDLHAA QLRKIDAMLD AAGVRKGTRL LEIGSGWGGL AIKAAGERGA TVLTVTLSEE       240
     QQELARRRIA AAGLAGRIEV RLADYREVAE EQPFDAVVSV EMIEAVGRRY LPDYFQAIER       300
     NLARGGRVAV QAITMAHHRM LATQDSYSWI HKYVFPGGLI PSIPELDFAA ETAGLRLAAR       360
     RDFGLDYART LRAWRHRFEE NWPKVAGHGF DEVFRRTWRF YLAYCEAGFA SGYLGVSQLT       420
     YTRP                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page