(data stored in ACNUC7421 zone)

EMBL: CP001700.PE149

CP001700.PE149       Location/Qualifiers
FT   CDS             complement(160146..160928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_2642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69104"
FT                   /db_xref="GOA:C7QHG5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG5"
FT                   /inference="similar to AA sequence:KEGG:SGR_2642"
FT                   /protein_id="ACU69104.1"
FT                   /translation="MSREEIHPASEPRLDPPVHPVRGGVVGVVLLAHGGKETSHEAPHR
FT                   RGGPVTRMRMIARAVAPRLAGRGVAVHTMCFRYQGWNGAERAPVPDVWWAAARLTERYG
FT                   EVPLVLAGHSLGGRAVVNAADAPGVVGVLGLAPWLPAQEPTGQLAGRRLLLAHGTRDRV
FT                   TSPRSSYEYAARARAEGHDVARIVLPGSGHTMLSRARDWNRLVLAFSHTCLLEQHVVAA
FT                   DANRTRPPRYADVIAEAFQAAAPEGLQRVLTPAGRVRS"
     MSREEIHPAS EPRLDPPVHP VRGGVVGVVL LAHGGKETSH EAPHRRGGPV TRMRMIARAV        60
     APRLAGRGVA VHTMCFRYQG WNGAERAPVP DVWWAAARLT ERYGEVPLVL AGHSLGGRAV       120
     VNAADAPGVV GVLGLAPWLP AQEPTGQLAG RRLLLAHGTR DRVTSPRSSY EYAARARAEG       180
     HDVARIVLPG SGHTMLSRAR DWNRLVLAFS HTCLLEQHVV AADANRTRPP RYADVIAEAF       240
     QAAAPEGLQR VLTPAGRVRS                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page