(data stored in ACNUC7421 zone)

EMBL: CP001700.PE15

CP001700.PE15        Location/Qualifiers
FT   CDS             16967..17629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0015"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68970"
FT                   /db_xref="GOA:C7QFN1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU68970.1"
FT                   /translation="MALHVDYAAQRAFSRIIAGLRSARLDAELSQNALATGLPVRGRAV
FT                   SEWETGAIEPTLGHLIQWSWELGRRLVIVGRDGELRYGPVRQRPGELWEAFERRRLAVP
FT                   LRNRRLALGMAQGELGELVGVSRDSIQRWELVRVPPRPIAHVVWAQKLGYSLDTRPVAD
FT                   GGPRLRRVGSAGLALPGLSGQIGQQGQPGLTGQAERSASGPGSPAGELRAAADGRRG"
     MALHVDYAAQ RAFSRIIAGL RSARLDAELS QNALATGLPV RGRAVSEWET GAIEPTLGHL        60
     IQWSWELGRR LVIVGRDGEL RYGPVRQRPG ELWEAFERRR LAVPLRNRRL ALGMAQGELG       120
     ELVGVSRDSI QRWELVRVPP RPIAHVVWAQ KLGYSLDTRP VADGGPRLRR VGSAGLALPG       180
     LSGQIGQQGQ PGLTGQAERS ASGPGSPAGE LRAAADGRRG                             220
//

If you have problems or comments...

PBIL Back to PBIL home page