(data stored in ACNUC7421 zone)

EMBL: CP001700.PE150

CP001700.PE150       Location/Qualifiers
FT   CDS             complement(160949..161347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0150"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   blj:BLD_1980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69105"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG6"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ACU69105.1"
FT                   /translation="MTGPATPETYRAIAELDGEWWVVTVPDLRGVYTQGRTYEQARAMA
FT                   RDAIATMLDTAPDRVAVAMEVRLPGHAEDTISEVARARAARDEAAAAEQRKLRESARRL
FT                   KAAGVKVVDAAVLLGVSKQRVYQLLTDH"
     MTGPATPETY RAIAELDGEW WVVTVPDLRG VYTQGRTYEQ ARAMARDAIA TMLDTAPDRV        60
     AVAMEVRLPG HAEDTISEVA RARAARDEAA AAEQRKLRES ARRLKAAGVK VVDAAVLLGV       120
     SKQRVYQLLT DH                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page