(data stored in ACNUC7421 zone)

EMBL: CP001700.PE152

CP001700.PE152       Location/Qualifiers
FT   CDS             complement(161660..162997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0152"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: fal:FRAAL6227 putative NADH
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69107"
FT                   /db_xref="GOA:C7QHG8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG8"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACU69107.1"
FT                   /translation="MGKASGNGKAIPRILIVGGGYVGMYTAHRILKKLGKDEALVTVVD
FT                   PRSYMTYQPFLPEAAAGSLSPRHVVVPLRSVLKRAEVLTARVTDIDQNRKVATIEPIAG
FT                   EPYELEFDQLVIAVGSIARTLPIPGLAENGIGFKQIEEAIALRNHVLGQMDIAATTKDE
FT                   KIRRRALTFVFIGGGFAGIEAIAELEDMARDACKIYPNIRPEDMRWVMVEGSGRILPEV
FT                   RPALGEYTVHELEKRGIQVKLNTFLESCVNRRVQLSDGTKMVASTIVWTAGVKPNPVVQ
FT                   RFGVPLGERGHVKAGATLQVEGFADVWSAGDGAQVPDLANPGKWCSPSAQHAVRQAKQL
FT                   ADNVVAAVRGFEPREYKHKHVGSVASLGLHKGVADVYNIRLRGWPAWFMHRTYHMSRVP
FT                   TFNRKIRVIADWTLALFFRREAVGLGSIERPRDEFAEAAGEQRKAA"
     MGKASGNGKA IPRILIVGGG YVGMYTAHRI LKKLGKDEAL VTVVDPRSYM TYQPFLPEAA        60
     AGSLSPRHVV VPLRSVLKRA EVLTARVTDI DQNRKVATIE PIAGEPYELE FDQLVIAVGS       120
     IARTLPIPGL AENGIGFKQI EEAIALRNHV LGQMDIAATT KDEKIRRRAL TFVFIGGGFA       180
     GIEAIAELED MARDACKIYP NIRPEDMRWV MVEGSGRILP EVRPALGEYT VHELEKRGIQ       240
     VKLNTFLESC VNRRVQLSDG TKMVASTIVW TAGVKPNPVV QRFGVPLGER GHVKAGATLQ       300
     VEGFADVWSA GDGAQVPDLA NPGKWCSPSA QHAVRQAKQL ADNVVAAVRG FEPREYKHKH       360
     VGSVASLGLH KGVADVYNIR LRGWPAWFMH RTYHMSRVPT FNRKIRVIAD WTLALFFRRE       420
     AVGLGSIERP RDEFAEAAGE QRKAA                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page