(data stored in ACNUC7421 zone)

EMBL: CP001700.PE153

CP001700.PE153       Location/Qualifiers
FT   CDS             complement(163334..164290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0153"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: sma:SAV_3530
FT                   exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69108"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG9"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ACU69108.1"
FT                   /translation="MTKRVAAIDCGTNSIRLLIADVHPRTGRTEDVVREMRIVRLGEGV
FT                   DATGRLAPAALERTFAACLEYQDLIERHSGGTPIPLRFVATSATRDAENRREFVEGVKG
FT                   ILGVEPYVATGDEEARFSFTGATSELPHDRHQAPYLVIDIGGGSTEFVLGDAERGVIAA
FT                   RSVDMGCVRMYERHLKTAGVATEAQVKAARADIEKLIDRAAEAVPLDEARTLVGLAGTV
FT                   TTLGAVALDLDEYDSERIHLSHIPLGRVRDITTRLLGLTPDERKAIPVIHPGRADVIGA
FT                   GALVLLAIMERVAPSLAAPEVVVSERDILDGIAASIA"
     MTKRVAAIDC GTNSIRLLIA DVHPRTGRTE DVVREMRIVR LGEGVDATGR LAPAALERTF        60
     AACLEYQDLI ERHSGGTPIP LRFVATSATR DAENRREFVE GVKGILGVEP YVATGDEEAR       120
     FSFTGATSEL PHDRHQAPYL VIDIGGGSTE FVLGDAERGV IAARSVDMGC VRMYERHLKT       180
     AGVATEAQVK AARADIEKLI DRAAEAVPLD EARTLVGLAG TVTTLGAVAL DLDEYDSERI       240
     HLSHIPLGRV RDITTRLLGL TPDERKAIPV IHPGRADVIG AGALVLLAIM ERVAPSLAAP       300
     EVVVSERDIL DGIAASIA                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page