(data stored in ACNUC7421 zone)

EMBL: CP001700.PE154

CP001700.PE154       Location/Qualifiers
FT   CDS             complement(164306..164869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0154"
FT                   /product="protein of unknown function DUF501"
FT                   /note="PFAM: protein of unknown function DUF501; KEGG:
FT                   sco:SCO3094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69109"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH0"
FT                   /inference="protein motif:PFAM:PF04417"
FT                   /protein_id="ACU69109.1"
FT                   /translation="MTNDAPTPDTSRPAPAAAPEADAVSQADLAAVEAQLSRTPRGVRR
FT                   VAHRCPCGNPDVVETAPRLPDGTPFPTLFYLTCPKAASAIGTLEASGLMKEMTERLKTD
FT                   PELAAAYRAADEEYRARRDAIEVLDGFPTAGGMPDRVKCLHVLVGHTLAAGPGVNPLGD
FT                   EALALLPEWWKSGPCVTPSEEPGA"
     MTNDAPTPDT SRPAPAAAPE ADAVSQADLA AVEAQLSRTP RGVRRVAHRC PCGNPDVVET        60
     APRLPDGTPF PTLFYLTCPK AASAIGTLEA SGLMKEMTER LKTDPELAAA YRAADEEYRA       120
     RRDAIEVLDG FPTAGGMPDR VKCLHVLVGH TLAAGPGVNP LGDEALALLP EWWKSGPCVT       180
     PSEEPGA                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page