(data stored in ACNUC7421 zone)

EMBL: CP001700.PE156

CP001700.PE156       Location/Qualifiers
FT   CDS             165467..167053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0156"
FT                   /product="Bilirubin oxidase"
FT                   /EC_number="1.3.3.5"
FT                   /note="PFAM: multicopper oxidase type 2; multicopper
FT                   oxidase type 3; multicopper oxidase type 1; KEGG:
FT                   sen:SACE_1822 spore coat protein (outer)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69111"
FT                   /db_xref="GOA:C7QHH2"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH2"
FT                   /inference="protein motif:PRIAM:1.3.3.5"
FT                   /protein_id="ACU69111.1"
FT                   /translation="MSGPRLSRRGALRLFGGAGAVAVLSPTLAGCAKPGNDGINPGTLS
FT                   SKAKLPKPFSIPLPILKPLAPDSTDAQGVHYSMTLKQAEVEILPGYRTKIFGYNGTFPG
FT                   PYLDVHAGTPMVVHQTNQLPVPIVTHLHGGLTPPSDDGFPTDLVFPQALADMADPGMAA
FT                   SMAGMDGMPSMKDPLAHLTAVQRDYVFPLNQRASTLWYHDHRMDFSGVQVWRGLFGLCV
FT                   LRDAEDDKLPLPKGEREIPLMIADRAFDADGQLIYPEKDPTLLGKPSMDKSIAAGAQGD
FT                   VILVNGAPWPYLEVAAVKYRLRLLNASNARRYELKLDGPGGGEFVQVGSDGGLLAAPLT
FT                   HSTLHMSPAERFDVVVDFSKYPVGSTVTLKNSAASGGPGQVMQFKVTSHAADDSSVPAT
FT                   LSTIEKLTVNGAKRRLVFALDGDQWHVNGKAFDPAHPLVKPEFGKTEQWTVTSVERHPV
FT                   HLHGAHFQVTGRGSGGLGEYDHGWKDTVELSPGSEITLAVRFDSYRGRYVAHCHNLEHE
FT                   DMGMMATIQVV"
     MSGPRLSRRG ALRLFGGAGA VAVLSPTLAG CAKPGNDGIN PGTLSSKAKL PKPFSIPLPI        60
     LKPLAPDSTD AQGVHYSMTL KQAEVEILPG YRTKIFGYNG TFPGPYLDVH AGTPMVVHQT       120
     NQLPVPIVTH LHGGLTPPSD DGFPTDLVFP QALADMADPG MAASMAGMDG MPSMKDPLAH       180
     LTAVQRDYVF PLNQRASTLW YHDHRMDFSG VQVWRGLFGL CVLRDAEDDK LPLPKGEREI       240
     PLMIADRAFD ADGQLIYPEK DPTLLGKPSM DKSIAAGAQG DVILVNGAPW PYLEVAAVKY       300
     RLRLLNASNA RRYELKLDGP GGGEFVQVGS DGGLLAAPLT HSTLHMSPAE RFDVVVDFSK       360
     YPVGSTVTLK NSAASGGPGQ VMQFKVTSHA ADDSSVPATL STIEKLTVNG AKRRLVFALD       420
     GDQWHVNGKA FDPAHPLVKP EFGKTEQWTV TSVERHPVHL HGAHFQVTGR GSGGLGEYDH       480
     GWKDTVELSP GSEITLAVRF DSYRGRYVAH CHNLEHEDMG MMATIQVV                    528
//

If you have problems or comments...

PBIL Back to PBIL home page