(data stored in ACNUC7421 zone)

EMBL: CP001700.PE157

CP001700.PE157       Location/Qualifiers
FT   CDS             complement(167197..168402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0157"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="PFAM: GAF domain protein; histidine kinase
FT                   dimerisation and phosphoacceptor region; SMART: GAF domain
FT                   protein; KEGG: sma:SAV_4257 two-component system sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69112"
FT                   /db_xref="GOA:C7QHH3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH3"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACU69112.1"
FT                   /translation="MSESRESPEIADLREALAASRRRESWLSAAADVITLMLIAVDPHE
FT                   VLTLVAERAREASGADHCSLLLQHVDGSWRIDVATGLAADQVRGAFVEPHRRSVQVAVT
FT                   GRALALEAGDVDPEELAPPFRRFGAIVYAALAQRDDRPIGTLVLANAPGGRTFDEEDAR
FT                   LATAFAHQAGLALALTEARAAEDRLAVYADRERIARDLHDLTIQRIFAAGLSLQTLSRR
FT                   LNSPGPDLPAAAGRLDGVIDELDAAIAEIRTTIFDLQLTADQEATSTRARVLREASRAA
FT                   RVLGFEPSVRFTGPLDSLVGGDTGAHLVAAVRETLANAAKHAGATRVEVVVTVETGPAT
FT                   TLTLDVLDDGGAPMPRWRPNPRTARQGLSNLAARARELGGSFHAGPADGDRGTRVSWRV
FT                   PL"
     MSESRESPEI ADLREALAAS RRRESWLSAA ADVITLMLIA VDPHEVLTLV AERAREASGA        60
     DHCSLLLQHV DGSWRIDVAT GLAADQVRGA FVEPHRRSVQ VAVTGRALAL EAGDVDPEEL       120
     APPFRRFGAI VYAALAQRDD RPIGTLVLAN APGGRTFDEE DARLATAFAH QAGLALALTE       180
     ARAAEDRLAV YADRERIARD LHDLTIQRIF AAGLSLQTLS RRLNSPGPDL PAAAGRLDGV       240
     IDELDAAIAE IRTTIFDLQL TADQEATSTR ARVLREASRA ARVLGFEPSV RFTGPLDSLV       300
     GGDTGAHLVA AVRETLANAA KHAGATRVEV VVTVETGPAT TLTLDVLDDG GAPMPRWRPN       360
     PRTARQGLSN LAARARELGG SFHAGPADGD RGTRVSWRVP L                           401
//

If you have problems or comments...

PBIL Back to PBIL home page