(data stored in ACNUC7421 zone)

EMBL: CP001700.PE158

CP001700.PE158       Location/Qualifiers
FT   CDS             complement(168565..169635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0158"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: sma:SAV_4261
FT                   putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69113"
FT                   /db_xref="GOA:C7QHH4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH4"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACU69113.1"
FT                   /translation="MADDVQTPKLREALRGIPAYKAGKNPDASAFKLSSNENPYPPLPG
FT                   VLEAVQKSAENFNRYPDMGCSALSSEIAERFGVPVEHVATGTGSVGVAQQLLQATSGPG
FT                   DEVIYAWRSFEAYPIITQISGATSVRVPLTPEEHHDLDAMAAAVTDRTRLIFVCNPNNP
FT                   TGVAISEDALVRFLDRVPSDVLVVIDEAYREFVRDDSIPDGVDLYRDRPNVAVLRTFSK
FT                   AYGLAGLRVGFAIAHEPVAAALRQTAVPFGVNSLAQVAAIESLRAEKLLLERCEALVQE
FT                   RTRVTEALREQGWTVPESQANFIWLRLGERTAEFAAKAEAAGIVVRPFAGEGARITVGE
FT                   VEANDILLRVTAEFQE"
     MADDVQTPKL REALRGIPAY KAGKNPDASA FKLSSNENPY PPLPGVLEAV QKSAENFNRY        60
     PDMGCSALSS EIAERFGVPV EHVATGTGSV GVAQQLLQAT SGPGDEVIYA WRSFEAYPII       120
     TQISGATSVR VPLTPEEHHD LDAMAAAVTD RTRLIFVCNP NNPTGVAISE DALVRFLDRV       180
     PSDVLVVIDE AYREFVRDDS IPDGVDLYRD RPNVAVLRTF SKAYGLAGLR VGFAIAHEPV       240
     AAALRQTAVP FGVNSLAQVA AIESLRAEKL LLERCEALVQ ERTRVTEALR EQGWTVPESQ       300
     ANFIWLRLGE RTAEFAAKAE AAGIVVRPFA GEGARITVGE VEANDILLRV TAEFQE           356
//

If you have problems or comments...

PBIL Back to PBIL home page