(data stored in ACNUC7421 zone)

EMBL: CP001700.PE159

CP001700.PE159       Location/Qualifiers
FT   CDS             169720..170865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_5011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69114"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH5"
FT                   /inference="similar to AA sequence:KEGG:SACE_5011"
FT                   /protein_id="ACU69114.1"
FT                   /translation="MTLNGFAYGELSFGADGQPADPTQRGAAPAVALGADVTDLLVLSH
FT                   GWLDDPPRAQILYAGLTEAIVQAGGAPPGLAVLGILWPSKRFDAEPEVQVAATVAATDP
FT                   SGRAAESFVTRVRHRVGAQLELLPVTAEYANPGDHQATFFGLEPRALLEKFGSIEDGID
FT                   AVLNLSTYYEMKGRAGAVGKGLVPVLAAVREARPEVRLHLAGHSFGARVMASALANCEA
FT                   FPVSSVTLIQGAFSQFGFAKQWDGVHDGLFRPGLFGGRLKGPVVVTHSRHDHMVGLAYE
FT                   LASRMAGDQPDTTGMAGHVHVHDEYGAIGSHGALSTPESVWGTMLPVQGAGYAFPAGAI
FT                   SNLDGNAYIPNHYHVMTPEMGKVLVAAMTACEAEYGVAEAS"
     MTLNGFAYGE LSFGADGQPA DPTQRGAAPA VALGADVTDL LVLSHGWLDD PPRAQILYAG        60
     LTEAIVQAGG APPGLAVLGI LWPSKRFDAE PEVQVAATVA ATDPSGRAAE SFVTRVRHRV       120
     GAQLELLPVT AEYANPGDHQ ATFFGLEPRA LLEKFGSIED GIDAVLNLST YYEMKGRAGA       180
     VGKGLVPVLA AVREARPEVR LHLAGHSFGA RVMASALANC EAFPVSSVTL IQGAFSQFGF       240
     AKQWDGVHDG LFRPGLFGGR LKGPVVVTHS RHDHMVGLAY ELASRMAGDQ PDTTGMAGHV       300
     HVHDEYGAIG SHGALSTPES VWGTMLPVQG AGYAFPAGAI SNLDGNAYIP NHYHVMTPEM       360
     GKVLVAAMTA CEAEYGVAEA S                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page