(data stored in ACNUC7421 zone)

EMBL: CP001700.PE16

CP001700.PE16        Location/Qualifiers
FT   CDS             complement(17749..18954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0016"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   sgr:SGR_3958 putative serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68971"
FT                   /db_xref="GOA:C7QFN2"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN2"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACU68971.1"
FT                   /translation="MTGFEHDPYQPEQPATGDPQPWGHPSSGPVLGPAHASASAYPPAY
FT                   PSASSPSPAASEPMPPYTPPITSITPGYGNPGEAGGLGGPGSFGGPGGFGGPGGPGGPG
FT                   YTTHPAFSPEPPRRPRRKRRMGMALIIAGTIAASAAAGGIAGTIASHNNSSNSASSSVP
FT                   LNNTSVNTPVSNQTGTPTTTVGQVAKAALPTVVQVSVESYQGKSVGSGVILTADGLILT
FT                   NNHVITDAANGNGQITITFNNGKTAQASIVGYDSGSDLAVIKAQSVSGLPTASLGDSSK
FT                   IQIGDTVVAIGSPDGLQSTVTSGIVSALNRQVTVSSESSSRFSSGSQVTYSAIQTDASL
FT                   NPGNSGGPLLNAQGQVIGINSAIYSPTSSANAQGGSVGLGFSIPIDQVKTMLAKLEGGQ
FT                   MS"
     MTGFEHDPYQ PEQPATGDPQ PWGHPSSGPV LGPAHASASA YPPAYPSASS PSPAASEPMP        60
     PYTPPITSIT PGYGNPGEAG GLGGPGSFGG PGGFGGPGGP GGPGYTTHPA FSPEPPRRPR       120
     RKRRMGMALI IAGTIAASAA AGGIAGTIAS HNNSSNSASS SVPLNNTSVN TPVSNQTGTP       180
     TTTVGQVAKA ALPTVVQVSV ESYQGKSVGS GVILTADGLI LTNNHVITDA ANGNGQITIT       240
     FNNGKTAQAS IVGYDSGSDL AVIKAQSVSG LPTASLGDSS KIQIGDTVVA IGSPDGLQST       300
     VTSGIVSALN RQVTVSSESS SRFSSGSQVT YSAIQTDASL NPGNSGGPLL NAQGQVIGIN       360
     SAIYSPTSSA NAQGGSVGLG FSIPIDQVKT MLAKLEGGQM S                           401
//

If you have problems or comments...

PBIL Back to PBIL home page