(data stored in ACNUC7421 zone)

EMBL: CP001700.PE160

CP001700.PE160       Location/Qualifiers
FT   CDS             170983..171954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0160"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: ThiJ/PfpI domain protein; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: bmj:BMULJ_02621 AraC subfamily transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69115"
FT                   /db_xref="GOA:C7QHH6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH6"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACU69115.1"
FT                   /translation="MSRRVVFLVFPRFQLLDLTGPLEVFSQADMLFSPGRQRYVTEVVA
FT                   LGAEPVTASDGLAVVPHRTLADAAELPIDTLVVVGGRGVRTAMTDPVYVEWVRAAAGRA
FT                   RRVTSVCSGTFLLAAAGLLDGRRAVTHWDSCEELAERFPEIRVEADPIFVRDDPLWTSA
FT                   GVTAGVDLALALVEDDLGAEVARRIAKQLVVFVQRPGGQAQFSTQLAAQRPGRDALRET
FT                   QTWIADHLDDNLSLAALARRAALSERHFSRVFRAETGMTVAAYVEAARIEAAQRLLEST
FT                   RDGLDRIARTCGFGTVETMHRTFNRTIRVTPGEYRRHFSSPR"
     MSRRVVFLVF PRFQLLDLTG PLEVFSQADM LFSPGRQRYV TEVVALGAEP VTASDGLAVV        60
     PHRTLADAAE LPIDTLVVVG GRGVRTAMTD PVYVEWVRAA AGRARRVTSV CSGTFLLAAA       120
     GLLDGRRAVT HWDSCEELAE RFPEIRVEAD PIFVRDDPLW TSAGVTAGVD LALALVEDDL       180
     GAEVARRIAK QLVVFVQRPG GQAQFSTQLA AQRPGRDALR ETQTWIADHL DDNLSLAALA       240
     RRAALSERHF SRVFRAETGM TVAAYVEAAR IEAAQRLLES TRDGLDRIAR TCGFGTVETM       300
     HRTFNRTIRV TPGEYRRHFS SPR                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page