(data stored in ACNUC7421 zone)

EMBL: CP001700.PE161

CP001700.PE161       Location/Qualifiers
FT   CDS             171991..172635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0161"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: sco:SCO6747
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69116"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH7"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACU69116.1"
FT                   /translation="MPRIAIPLFPGFMPLDVVGPYDVLRFLPDHEVVFVASDPGVINGA
FT                   DGGFGLQAQATPADIDTCDILLVPGGRGTRDHAARKDLTDWIARIHQTTTWTTSVCTGS
FT                   LLLGAAGILTDTDATTHWNAIPALESFGAHYTPERVVRRGKVVTAAGVSSGIDMALTLA
FT                   GLIEGDEFAQAVQLWIEYDPQPPHDTGSVAKAGADLTARTPGLIGGGGRRG"
     MPRIAIPLFP GFMPLDVVGP YDVLRFLPDH EVVFVASDPG VINGADGGFG LQAQATPADI        60
     DTCDILLVPG GRGTRDHAAR KDLTDWIARI HQTTTWTTSV CTGSLLLGAA GILTDTDATT       120
     HWNAIPALES FGAHYTPERV VRRGKVVTAA GVSSGIDMAL TLAGLIEGDE FAQAVQLWIE       180
     YDPQPPHDTG SVAKAGADLT ARTPGLIGGG GRRG                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page