(data stored in ACNUC7421 zone)

EMBL: CP001700.PE162

CP001700.PE162       Location/Qualifiers
FT   CDS             172943..173746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0162"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sen:SACE_3371 3-oxoacyl-[acyl-carrier- protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69117"
FT                   /db_xref="GOA:C7QHH8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69117.1"
FT                   /translation="MDLGLRGRVAVVTGGSKGIGLAVVRTLLEEGAFVVAVSRAGSAGL
FT                   GEVGGPNLLHVAGDLMDAGFAAEVVEQTVAAFGGLDILVNNAGGPPPGVVLPRGPFLGG
FT                   GDVDWQAVFDFNLFAVVRLTRVALPHLIERGGTIVNVSSTLARQPATNNYEYSAAKAAL
FT                   SHVSKGLAEEFGPQGVRVNTVLPGVTRTNWWTDEGGVADMFAGAMGIDRDTLLDKALPE
FT                   SLRLSMGRIVEPQEVADAVVLLASPRSRSTNGSEFVVDGGLLKEL"
     MDLGLRGRVA VVTGGSKGIG LAVVRTLLEE GAFVVAVSRA GSAGLGEVGG PNLLHVAGDL        60
     MDAGFAAEVV EQTVAAFGGL DILVNNAGGP PPGVVLPRGP FLGGGDVDWQ AVFDFNLFAV       120
     VRLTRVALPH LIERGGTIVN VSSTLARQPA TNNYEYSAAK AALSHVSKGL AEEFGPQGVR       180
     VNTVLPGVTR TNWWTDEGGV ADMFAGAMGI DRDTLLDKAL PESLRLSMGR IVEPQEVADA       240
     VVLLASPRSR STNGSEFVVD GGLLKEL                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page