(data stored in ACNUC7421 zone)

EMBL: CP001700.PE163

CP001700.PE163       Location/Qualifiers
FT   CDS             173877..175469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0163"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: mjl:Mjls_4686
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69118"
FT                   /db_xref="GOA:C7QHH9"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH9"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACU69118.1"
FT                   /translation="MPVLRSQLDPTSEAARADREAVLGALERIRELQQKVLAGGGEKYA
FT                   ERHRSRGKLLARERLDLLLDEDSPFLELAALAGTHDPAETVGGVSGIGTVSGVECMIGA
FT                   NDPTVKGGAVGPSGVAKQLRMLEIAERNRLPLISLTESAGADLPRQADIFVPGGASFKG
FT                   ISRLSAAGIPTLSIVFGSSTAGGAYVPGMSEFTVMVKNQAAVYLGGPPLVKMAINEDTD
FT                   DETLGGADMHARVSGLADYLARDERDAIRIGRQIIADLRWRKRGPGPTESADEPLYAAE
FT                   DLLSLAPMDLRRPVEVREILARVLDGSRFSEFKPLYGTTLVCGWGSIHGYPVGILANNG
FT                   ILFSEEANKGAHFVQLANAREVPLLFVQNITGFMVGSRYERGGIIKDGSKLINAVSNSA
FT                   VPHVTLMVGASYGAGNYGMSGRAYDPRFVFTWPNHRIAVMGGRELAGVMSIVQRQKAEK
FT                   AGQPYDEAADAQTREFVEAMVDGQSDAVYASGRLWDDGVIDPRQSRTVLGLALSAIDSG
FT                   PVVGTRAFAPFRM"
     MPVLRSQLDP TSEAARADRE AVLGALERIR ELQQKVLAGG GEKYAERHRS RGKLLARERL        60
     DLLLDEDSPF LELAALAGTH DPAETVGGVS GIGTVSGVEC MIGANDPTVK GGAVGPSGVA       120
     KQLRMLEIAE RNRLPLISLT ESAGADLPRQ ADIFVPGGAS FKGISRLSAA GIPTLSIVFG       180
     SSTAGGAYVP GMSEFTVMVK NQAAVYLGGP PLVKMAINED TDDETLGGAD MHARVSGLAD       240
     YLARDERDAI RIGRQIIADL RWRKRGPGPT ESADEPLYAA EDLLSLAPMD LRRPVEVREI       300
     LARVLDGSRF SEFKPLYGTT LVCGWGSIHG YPVGILANNG ILFSEEANKG AHFVQLANAR       360
     EVPLLFVQNI TGFMVGSRYE RGGIIKDGSK LINAVSNSAV PHVTLMVGAS YGAGNYGMSG       420
     RAYDPRFVFT WPNHRIAVMG GRELAGVMSI VQRQKAEKAG QPYDEAADAQ TREFVEAMVD       480
     GQSDAVYASG RLWDDGVIDP RQSRTVLGLA LSAIDSGPVV GTRAFAPFRM                  530
//

If you have problems or comments...

PBIL Back to PBIL home page