(data stored in ACNUC7421 zone)

EMBL: CP001700.PE164

CP001700.PE164       Location/Qualifiers
FT   CDS             175557..177545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0164"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain ATP-
FT                   binding; biotin carboxylase domain protein; biotin/lipoyl
FT                   attachment domain-containing protein; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; KEGG: mgi:Mflv_4614
FT                   carbamoyl-phosphate synthase L chain, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69119"
FT                   /db_xref="GOA:C7QHI0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI0"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACU69119.1"
FT                   /translation="MPTYPTFSTVLVANRGEIARRVFRTAKAMGLRTVAVYSDPDADAP
FT                   HVREADVAVALGGSTSAESYLDAAKILDAARKTGADAVHPGYGFLSENAGFAEACAQAG
FT                   IVFVGPSPDAIRKMGIKHEAKAIAKAAGVPVLPDALLTTDEPDDWRRSSEGVGFPLLVK
FT                   ASAGGGGKGMRLVSSVEELENAVSGARREAAAAFGDGTVFLERYLAASRHIEIQVFGDT
FT                   HGNAVFYGERECSVQRRHQKVVEEAPSSAVGAAVRAKMGEVACALVRELGYVGAGTVEF
FT                   LFDDTDDSYYFLEMNTRLQVEHPVTEEVWGQDLVRRQFEVAAGAVLTAPDPEALHGHAI
FT                   EVRLYAEDPARKYIPSPGTLALYEHADVPGIRYEDGVRSGSVVSHYYDPMLSKVVATGL
FT                   TRGEAALKLASALAGMRIQGLKTNRDQLVAILRDPDFLAGTTRTDFLDLHPALAAPEDR
FT                   TDVTAHLAAALAVSVHRRRSAGGATAFAPAGWRLLPYDGANAAWTRQDVRRAPETPITY
FT                   RFDSSTLYLIHGGAEYEVSLRDLGPDSVRVAVDGVDRLCRVRVAEDTVVWVDDSDGGHS
FT                   AWKPTPRFPEDADAFAADDGAAEVPGTVVAISVAAGDRVKAGQVLVSMEAMKMEHQVKA
FT                   GRDGVVGSVDCAVGQFVDAHQVLVTLT"
     MPTYPTFSTV LVANRGEIAR RVFRTAKAMG LRTVAVYSDP DADAPHVREA DVAVALGGST        60
     SAESYLDAAK ILDAARKTGA DAVHPGYGFL SENAGFAEAC AQAGIVFVGP SPDAIRKMGI       120
     KHEAKAIAKA AGVPVLPDAL LTTDEPDDWR RSSEGVGFPL LVKASAGGGG KGMRLVSSVE       180
     ELENAVSGAR REAAAAFGDG TVFLERYLAA SRHIEIQVFG DTHGNAVFYG ERECSVQRRH       240
     QKVVEEAPSS AVGAAVRAKM GEVACALVRE LGYVGAGTVE FLFDDTDDSY YFLEMNTRLQ       300
     VEHPVTEEVW GQDLVRRQFE VAAGAVLTAP DPEALHGHAI EVRLYAEDPA RKYIPSPGTL       360
     ALYEHADVPG IRYEDGVRSG SVVSHYYDPM LSKVVATGLT RGEAALKLAS ALAGMRIQGL       420
     KTNRDQLVAI LRDPDFLAGT TRTDFLDLHP ALAAPEDRTD VTAHLAAALA VSVHRRRSAG       480
     GATAFAPAGW RLLPYDGANA AWTRQDVRRA PETPITYRFD SSTLYLIHGG AEYEVSLRDL       540
     GPDSVRVAVD GVDRLCRVRV AEDTVVWVDD SDGGHSAWKP TPRFPEDADA FAADDGAAEV       600
     PGTVVAISVA AGDRVKAGQV LVSMEAMKME HQVKAGRDGV VGSVDCAVGQ FVDAHQVLVT       660
     LT                                                                      662
//

If you have problems or comments...

PBIL Back to PBIL home page