(data stored in ACNUC7421 zone)

EMBL: CP001700.PE165

CP001700.PE165       Location/Qualifiers
FT   CDS             177622..178383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0165"
FT                   /product="acyl-CoA synthase"
FT                   /note="KEGG: mav:MAV_3523 acyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69120"
FT                   /db_xref="GOA:C7QHI1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI1"
FT                   /inference="similar to AA sequence:KEGG:MAV_3523"
FT                   /protein_id="ACU69120.1"
FT                   /translation="MPATQSTETRDPVEFHWLGDIVRVNLDGNTHGSVLAYGAQEWDWT
FT                   EFDSRIRKCVTGIRSDRLQRGQRVAVLARNHPVHFETLFAASNMGLVCTWLDWRLDRAH
FT                   VVHALNESEARILFVGEEFLDLVEDSMMEISSVVSTITVGGPEDEYEEWLETHETHEAL
FT                   LRAAREVAASSGRGDEPVLRLYSSTGKKGPTRGEYTHRALLTSAVEILRRKSLTRGDVE
FT                   AVDAPVTVHEAAVRVLANMSAGAATVLVQEE"
     MPATQSTETR DPVEFHWLGD IVRVNLDGNT HGSVLAYGAQ EWDWTEFDSR IRKCVTGIRS        60
     DRLQRGQRVA VLARNHPVHF ETLFAASNMG LVCTWLDWRL DRAHVVHALN ESEARILFVG       120
     EEFLDLVEDS MMEISSVVST ITVGGPEDEY EEWLETHETH EALLRAAREV AASSGRGDEP       180
     VLRLYSSTGK KGPTRGEYTH RALLTSAVEI LRRKSLTRGD VEAVDAPVTV HEAAVRVLAN       240
     MSAGAATVLV QEE                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page