(data stored in ACNUC7421 zone)

EMBL: CP001700.PE166

CP001700.PE166       Location/Qualifiers
FT   CDS             complement(178394..179059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0166"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sgr:SGR_4377
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69121"
FT                   /db_xref="GOA:C7QHI2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69121.1"
FT                   /translation="MSGKERREQLIEIGRTLFAERGFDATSVEEIATKAGVSKPVVYEH
FT                   FGGKEGLYAVVVDREMAKLLSMVTSGLTGEHARELLEQAAFALLDYIESSTDGFRILVR
FT                   DSPVTTSTGNFASLISDIASQVEDLLGVHFMHRGYDPKLAPMYAQMLVGMVALTGQWWL
FT                   DVRKPPKAEVAAHLVNLAWNGLSHLEGQPRLIVQEQAEAKVRRAARKTERAARADAKR"
     MSGKERREQL IEIGRTLFAE RGFDATSVEE IATKAGVSKP VVYEHFGGKE GLYAVVVDRE        60
     MAKLLSMVTS GLTGEHAREL LEQAAFALLD YIESSTDGFR ILVRDSPVTT STGNFASLIS       120
     DIASQVEDLL GVHFMHRGYD PKLAPMYAQM LVGMVALTGQ WWLDVRKPPK AEVAAHLVNL       180
     AWNGLSHLEG QPRLIVQEQA EAKVRRAARK TERAARADAK R                           221
//

If you have problems or comments...

PBIL Back to PBIL home page