(data stored in ACNUC7421 zone)

EMBL: CP001700.PE167

CP001700.PE167       Location/Qualifiers
FT   CDS             complement(179179..180144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0167"
FT                   /product="Stearoyl-CoA 9-desaturase"
FT                   /EC_number="1.14.19.1"
FT                   /note="PFAM: fatty acid desaturase; KEGG: sgr:SGR_4378
FT                   putative fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69122"
FT                   /db_xref="GOA:C7QHI3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI3"
FT                   /inference="protein motif:PRIAM:1.14.19.1"
FT                   /protein_id="ACU69122.1"
FT                   /translation="MTQTSVPQQQPTAPATVRGTRGGETQSFKERIALSFVIGVPFAAL
FT                   VIAVPVVWGWGMTWTDLIIAVVMYAISGHGVTVGFHRLFTHSSFKAKKALRVGLAIAGS
FT                   LAVQGPVIRWVADHRKHHRYSDHDGDPHSPWRYGETLPALMKGLWHAHIGWLYNAEQTN
FT                   QQQYAPDLLKDRAIVRVSRAFPYLVLVSLLLPAAVGGLVTWSWQGILTAFFWGSLVRIA
FT                   LLHHTTWSINSICHAVGERPFRSRDRSGNVWWLAVLSMGESWHNLHHSDPTAARHGVLR
FT                   GQIDSSARIIWLFEKFGWVRDVRWPSRERVALKLRGEAAP"
     MTQTSVPQQQ PTAPATVRGT RGGETQSFKE RIALSFVIGV PFAALVIAVP VVWGWGMTWT        60
     DLIIAVVMYA ISGHGVTVGF HRLFTHSSFK AKKALRVGLA IAGSLAVQGP VIRWVADHRK       120
     HHRYSDHDGD PHSPWRYGET LPALMKGLWH AHIGWLYNAE QTNQQQYAPD LLKDRAIVRV       180
     SRAFPYLVLV SLLLPAAVGG LVTWSWQGIL TAFFWGSLVR IALLHHTTWS INSICHAVGE       240
     RPFRSRDRSG NVWWLAVLSM GESWHNLHHS DPTAARHGVL RGQIDSSARI IWLFEKFGWV       300
     RDVRWPSRER VALKLRGEAA P                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page