(data stored in ACNUC7421 zone)

EMBL: CP001700.PE168

CP001700.PE168       Location/Qualifiers
FT   CDS             180559..182085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0168"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: Nucleotidyl transferase; transferase hexapeptide
FT                   repeat containing protein; KEGG: sco:SCO3122
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69123"
FT                   /db_xref="GOA:C7QHI4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI4"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACU69123.1"
FT                   /translation="MTDQHAPTVIILAAGEGKRMKSATPKVLHELCGRTMLGHVVAAAQ
FT                   DLAPSRLAVVVGKGRDLVAPHVAAIAPEARIVVQEPQNGTGQAARLALEALVAEGGPAE
FT                   GTVLVLLGDGAMVTGGTLRHLIAVHESSGNAVTDLTAVVPDPRGLGRILREPDGTAEGR
FT                   VLGIVEEKDCTPAQATIPEINSGIFAFDGKLLRDALSRLTTDNAQGEELLTDVLAIAVG
FT                   DGLPVGAVVAADYHEVLAANDRAQLADLRRLMNQRITRQWMLEGVTIVDPATTWIDVHA
FT                   TLEPDATIRPNTQLEGATRIAAGADVGPNCTLRDTVVGERARVTNATTDGAEIGPEASV
FT                   GPYTYLRPGTKLGRKSKAGGFVEMKKSTIGEGTKVPHLAYIGDATIGAGTNIGAGVITA
FT                   NYDGYNKFPTRIGDHAFVGTNTTLIAPAEVADGAYIAAGSAVNMPVGPGELAVARGRQR
FT                   NIAGYVARKRPDSVAAQAAARAAERAAAGGQPAVETNPTGGGPGAQADAV"
     MTDQHAPTVI ILAAGEGKRM KSATPKVLHE LCGRTMLGHV VAAAQDLAPS RLAVVVGKGR        60
     DLVAPHVAAI APEARIVVQE PQNGTGQAAR LALEALVAEG GPAEGTVLVL LGDGAMVTGG       120
     TLRHLIAVHE SSGNAVTDLT AVVPDPRGLG RILREPDGTA EGRVLGIVEE KDCTPAQATI       180
     PEINSGIFAF DGKLLRDALS RLTTDNAQGE ELLTDVLAIA VGDGLPVGAV VAADYHEVLA       240
     ANDRAQLADL RRLMNQRITR QWMLEGVTIV DPATTWIDVH ATLEPDATIR PNTQLEGATR       300
     IAAGADVGPN CTLRDTVVGE RARVTNATTD GAEIGPEASV GPYTYLRPGT KLGRKSKAGG       360
     FVEMKKSTIG EGTKVPHLAY IGDATIGAGT NIGAGVITAN YDGYNKFPTR IGDHAFVGTN       420
     TTLIAPAEVA DGAYIAAGSA VNMPVGPGEL AVARGRQRNI AGYVARKRPD SVAAQAAARA       480
     AERAAAGGQP AVETNPTGGG PGAQADAV                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page