(data stored in ACNUC7421 zone)

EMBL: CP001700.PE169

CP001700.PE169       Location/Qualifiers
FT   CDS             182148..183128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0169"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: sgr:SGR_4383 putative ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69124"
FT                   /db_xref="GOA:C7QHI5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI5"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACU69124.1"
FT                   /translation="MTGLKTTGEKKLMLFTGRAYPELAQEVAEELGVEIAPMKAHDFAN
FT                   GEIYTRFEESVRGSDAFVIQCHSAPINHSIMEQLIMVDALKRASSKRITVITPFYGYAR
FT                   QDKKHKGREPISARLMADFFATAGADRLMAVDLHTDQIQGYFDGPVDHLFALPVLVDYI
FT                   KGKYDTSKLTVVSPDAGRVRTADRWTDRLNTPLAIVHKRRDPNIPNTVSVHEIVGEVKG
FT                   RTCVLVDDMVDTAGTICAAAEALFENGAAEVIIAATHAVLSDPATDRLKNSRISEVIFT
FT                   NTLPIPDEKRFDKMTVLSIAPMLARAIREVFEDGSVTSMFDDHKH"
     MTGLKTTGEK KLMLFTGRAY PELAQEVAEE LGVEIAPMKA HDFANGEIYT RFEESVRGSD        60
     AFVIQCHSAP INHSIMEQLI MVDALKRASS KRITVITPFY GYARQDKKHK GREPISARLM       120
     ADFFATAGAD RLMAVDLHTD QIQGYFDGPV DHLFALPVLV DYIKGKYDTS KLTVVSPDAG       180
     RVRTADRWTD RLNTPLAIVH KRRDPNIPNT VSVHEIVGEV KGRTCVLVDD MVDTAGTICA       240
     AAEALFENGA AEVIIAATHA VLSDPATDRL KNSRISEVIF TNTLPIPDEK RFDKMTVLSI       300
     APMLARAIRE VFEDGSVTSM FDDHKH                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page