(data stored in ACNUC7421 zone)

EMBL: CP001700.PE17

CP001700.PE17        Location/Qualifiers
FT   CDS             19091..19840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68972"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN3"
FT                   /inference="similar to AA sequence:KEGG:SGR_419"
FT                   /protein_id="ACU68972.1"
FT                   /translation="MDRDPLPDARALVRERYPQAVYAVLAGSVLTAHRTPGSDLDIVVA
FT                   LPPGDPLAPRRESLVFRDWPVELFVHDEQTLDQWLAKEYRERKPSLYRMVGRGTPIVGD
FT                   PADRQAYCRAVLDAGPDPMGPAQLEAARYGLTDLLDDLFHAGDPGERQVIAATLWTAAG
FT                   HHALVAGNRWDGTGKWLLRELRDHDPDLADRWLAAQHDAAAVEAFARDVLDRLGGPLFD
FT                   GYQAVAPRAETTKTTKTTKTTEFTRST"
     MDRDPLPDAR ALVRERYPQA VYAVLAGSVL TAHRTPGSDL DIVVALPPGD PLAPRRESLV        60
     FRDWPVELFV HDEQTLDQWL AKEYRERKPS LYRMVGRGTP IVGDPADRQA YCRAVLDAGP       120
     DPMGPAQLEA ARYGLTDLLD DLFHAGDPGE RQVIAATLWT AAGHHALVAG NRWDGTGKWL       180
     LRELRDHDPD LADRWLAAQH DAAAVEAFAR DVLDRLGGPL FDGYQAVAPR AETTKTTKTT       240
     KTTEFTRST                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page