(data stored in ACNUC7421 zone)

EMBL: CP001700.PE170

CP001700.PE170       Location/Qualifiers
FT   CDS             183392..184015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0170"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   tfu:Tfu_0416 50S ribosomal protein L25/general stress
FT                   protein Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69125"
FT                   /db_xref="GOA:C7QHI6"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI6"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ACU69125.1"
FT                   /translation="MSQIRISAEDRTEFGKGFARRARAVNKVPAVVYGHGEPVRHILLP
FT                   GHDLMIALRTPNVLLNLEFGDGKAQLVLPKDVQKDPVKRTLEHVDLVLVRSGEKVTVDI
FT                   PITVTGEVVGGAVLDHSLNNLTVTAEATHIPTGIEVDVDRKEEGFQLFVRDLELPAGSE
FT                   LVTDGDQLVLQVVVTRAEVSEEAAEGEGDAEGEAAEGASEESAE"
     MSQIRISAED RTEFGKGFAR RARAVNKVPA VVYGHGEPVR HILLPGHDLM IALRTPNVLL        60
     NLEFGDGKAQ LVLPKDVQKD PVKRTLEHVD LVLVRSGEKV TVDIPITVTG EVVGGAVLDH       120
     SLNNLTVTAE ATHIPTGIEV DVDRKEEGFQ LFVRDLELPA GSELVTDGDQ LVLQVVVTRA       180
     EVSEEAAEGE GDAEGEAAEG ASEESAE                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page