(data stored in ACNUC7421 zone)

EMBL: CP001700.PE171

CP001700.PE171       Location/Qualifiers
FT   CDS             184044..184640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0171"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: sco:SCO3125 peptidyl-tRNA hydrolase; TIGRFAM:
FT                   peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69126"
FT                   /db_xref="GOA:C7QHI7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI7"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ACU69126.1"
FT                   /translation="MTTTEARDQLWLIAGLGNPGPGYAGNRHNAGFMVVDLLAARVGGK
FT                   FKSHKARADVVEGRLGVGGPRVVLAKPKTFMNLSGGPVKALRDFYKIEPAQIIAVHDEL
FT                   DVDYGVLRLKLGGGDNGHNGLRSITSSLGTKEYHRVRFGVGRPPGRQDPADFVLKDFSS
FT                   TEKKDLDYNVDRAADAVEDLIRRGLVEAQNIYHAA"
     MTTTEARDQL WLIAGLGNPG PGYAGNRHNA GFMVVDLLAA RVGGKFKSHK ARADVVEGRL        60
     GVGGPRVVLA KPKTFMNLSG GPVKALRDFY KIEPAQIIAV HDELDVDYGV LRLKLGGGDN       120
     GHNGLRSITS SLGTKEYHRV RFGVGRPPGR QDPADFVLKD FSSTEKKDLD YNVDRAADAV       180
     EDLIRRGLVE AQNIYHAA                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page