(data stored in ACNUC7421 zone)

EMBL: CP001700.PE172

CP001700.PE172       Location/Qualifiers
FT   CDS             184839..185807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0172"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO5452 ABC transporter, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69127"
FT                   /db_xref="GOA:C7QHI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU69127.1"
FT                   /translation="MPAIEVRGLRKAYGDVTAVEDVSFEVAEGEIFGILGPNGAGKTTT
FT                   VECVSGLRTPDAGEVRVLGLDPRRDREDVRQVLGVQLQESQLPGKIHVREALELYASFY
FT                   RDPADVDRLLAQWELTEKAGARFGKLSGGQKQRLAVALAMVGKPRVVVLDELTTGLDPH
FT                   ARRTAWEMVQAVRDSGVTVLLVTHFMEEAERLCDRVAIIDAGRVVALDTPAAMAARGPA
FT                   AGQRMRFRPSAPVEDADLLALPEVRSVERHGAHLEVSGTSEVIGAVTAYLARRQIIAAE
FT                   LRVEQSSLDDAFIALTTHATTTTHAAQTMQTAQTAQTAKES"
     MPAIEVRGLR KAYGDVTAVE DVSFEVAEGE IFGILGPNGA GKTTTVECVS GLRTPDAGEV        60
     RVLGLDPRRD REDVRQVLGV QLQESQLPGK IHVREALELY ASFYRDPADV DRLLAQWELT       120
     EKAGARFGKL SGGQKQRLAV ALAMVGKPRV VVLDELTTGL DPHARRTAWE MVQAVRDSGV       180
     TVLLVTHFME EAERLCDRVA IIDAGRVVAL DTPAAMAARG PAAGQRMRFR PSAPVEDADL       240
     LALPEVRSVE RHGAHLEVSG TSEVIGAVTA YLARRQIIAA ELRVEQSSLD DAFIALTTHA       300
     TTTTHAAQTM QTAQTAQTAK ES                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page