(data stored in ACNUC7421 zone)

EMBL: CP001700.PE173

CP001700.PE173       Location/Qualifiers
FT   CDS             185807..186595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0173"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sgr:SGR_876
FT                   putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69128"
FT                   /db_xref="GOA:C7QHI9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI9"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU69128.1"
FT                   /translation="MSTATFSSRSSRLLPEFRMTGNGFRTLVRTQARLLWREPAVVLSG
FT                   IALPVLLIIVFGCIPSFGKPAASLGGRTTMDVYVPTFAMLSSVLTALTALPVTFADLRE
FT                   RGVLRRLAVSPVPAAGLLAAQVTVIATTAAVTAASVVLIGVAGFGASLPAHLALVLASY
FT                   ILGTTALLAIGLLIAALAPSAGVATGFGVPTMILNFFFAGVYVPLQQLPSVLRTASGFV
FT                   PYGAIVDTWSGTGAAWQHLTVLAVYTVVGALAAARVFKWE"
     MSTATFSSRS SRLLPEFRMT GNGFRTLVRT QARLLWREPA VVLSGIALPV LLIIVFGCIP        60
     SFGKPAASLG GRTTMDVYVP TFAMLSSVLT ALTALPVTFA DLRERGVLRR LAVSPVPAAG       120
     LLAAQVTVIA TTAAVTAASV VLIGVAGFGA SLPAHLALVL ASYILGTTAL LAIGLLIAAL       180
     APSAGVATGF GVPTMILNFF FAGVYVPLQQ LPSVLRTASG FVPYGAIVDT WSGTGAAWQH       240
     LTVLAVYTVV GALAAARVFK WE                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page