(data stored in ACNUC7421 zone)

EMBL: CP001700.PE174

CP001700.PE174       Location/Qualifiers
FT   CDS             186609..187907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0174"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   sco:SCO5454 two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69129"
FT                   /db_xref="GOA:C7QHJ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69129.1"
FT                   /translation="MVESATVQRWIPYAGLAVSLTLALIIGPRTGVYYTVVLGGSAAAA
FT                   LWVRRGRALLDAPNPPVLRATVYYAVLLALLATLILTSPLFGFFGFTGYLHAMVLPGRT
FT                   KLFGIAGTAGAMATTQMGGIVNIHGAGVYLYLVLVAVNLLIAGTLTVTGAAEEEHRREL
FT                   AEANERLHEMLEENAGLHAQLVAQAREAGVLDERQRLAGEIHDTIAQGLTGIVRQLEVV
FT                   ERFDDDVERRKHHLTLARELARESLAEARRSVQALRPGPLAVAQLPEALAELAASWSRT
FT                   AGIEARVEVSGEAVALSPEVEVALFRAAQEALANAGKYSGAGRVGVTVSYTSDVVVLDV
FT                   VDDGAGFDPEEVRRRGADSASENGTGYGLSAMRSRLRQVGGTLTIESEPGDGTAISAAV
FT                   PLVTLAAETASAGASARASTGAVAEAVTEAVTG"
     MVESATVQRW IPYAGLAVSL TLALIIGPRT GVYYTVVLGG SAAAALWVRR GRALLDAPNP        60
     PVLRATVYYA VLLALLATLI LTSPLFGFFG FTGYLHAMVL PGRTKLFGIA GTAGAMATTQ       120
     MGGIVNIHGA GVYLYLVLVA VNLLIAGTLT VTGAAEEEHR RELAEANERL HEMLEENAGL       180
     HAQLVAQARE AGVLDERQRL AGEIHDTIAQ GLTGIVRQLE VVERFDDDVE RRKHHLTLAR       240
     ELARESLAEA RRSVQALRPG PLAVAQLPEA LAELAASWSR TAGIEARVEV SGEAVALSPE       300
     VEVALFRAAQ EALANAGKYS GAGRVGVTVS YTSDVVVLDV VDDGAGFDPE EVRRRGADSA       360
     SENGTGYGLS AMRSRLRQVG GTLTIESEPG DGTAISAAVP LVTLAAETAS AGASARASTG       420
     AVAEAVTEAV TG                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page