(data stored in ACNUC7421 zone)

EMBL: CP001700.PE175

CP001700.PE175       Location/Qualifiers
FT   CDS             187936..188604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0175"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: sco:SCO5455 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69130"
FT                   /db_xref="GOA:C7QHJ1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69130.1"
FT                   /translation="MIDRVSGDSSPLRLLIVDDHPIVRDGLRGVFDGEDGFEVVGEASD
FT                   GAQALVRAAESGPDVVLMDLRMPTMGGVEAIRRLRVEQPAVRVLVLTTYDTESDVLPAI
FT                   EAGATGYLLKDAPREDLIRAVRAAAAGQPVLAPTVAQRLMTRVQTPLAEPAPPGDALTE
FT                   RELEVLRLVASGTTNRETARKLFISEATVKTHLLHAYAKFGVRDRAAAVAEAYKRGLLK
FT                   "
     MIDRVSGDSS PLRLLIVDDH PIVRDGLRGV FDGEDGFEVV GEASDGAQAL VRAAESGPDV        60
     VLMDLRMPTM GGVEAIRRLR VEQPAVRVLV LTTYDTESDV LPAIEAGATG YLLKDAPRED       120
     LIRAVRAAAA GQPVLAPTVA QRLMTRVQTP LAEPAPPGDA LTERELEVLR LVASGTTNRE       180
     TARKLFISEA TVKTHLLHAY AKFGVRDRAA AVAEAYKRGL LK                          222
//

If you have problems or comments...

PBIL Back to PBIL home page