(data stored in ACNUC7421 zone)

EMBL: CP001700.PE176

CP001700.PE176       Location/Qualifiers
FT   CDS             complement(188628..188966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0176"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   mlo:mll3541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69131"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ2"
FT                   /inference="protein motif:PFAM:PF07045"
FT                   /protein_id="ACU69131.1"
FT                   /translation="MTAYALAHVRSVELCADIVEYLERIQGTMDPFGGRFAFHGGEKEV
FT                   VEGAWTGDLILIEFPTLDAVHSWWTSPEYRAIKNLRTDHMAADIVVFDTLPADYNVGAT
FT                   AAKLAKLL"
     MTAYALAHVR SVELCADIVE YLERIQGTMD PFGGRFAFHG GEKEVVEGAW TGDLILIEFP        60
     TLDAVHSWWT SPEYRAIKNL RTDHMAADIV VFDTLPADYN VGATAAKLAK LL               112
//

If you have problems or comments...

PBIL Back to PBIL home page