(data stored in ACNUC7421 zone)

EMBL: CP001700.PE177

CP001700.PE177       Location/Qualifiers
FT   CDS             189108..189254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69132"
FT                   /db_xref="GOA:C7QHJ3"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69132.1"
FT                   /translation="MSSMGMVLNAFIAAAVGGICLSGLFKRGRERRVARISGTADRYEA
FT                   PVR"
     MSSMGMVLNA FIAAAVGGIC LSGLFKRGRE RRVARISGTA DRYEAPVR                     48
//

If you have problems or comments...

PBIL Back to PBIL home page