(data stored in ACNUC7421 zone)

EMBL: CP001700.PE178

CP001700.PE178       Location/Qualifiers
FT   CDS             complement(189512..192334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0178"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   sco:SCO3127 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69133"
FT                   /db_xref="GOA:C7QHJ4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ4"
FT                   /inference="protein motif:PRIAM:4.1.1.31"
FT                   /protein_id="ACU69133.1"
FT                   /translation="MSAVPSPKNDDAAVETPTDSPTARANDTANDNPPRTADDAELRAA
FT                   IRRLGDLLGQTLVRQHGPELLEQVEAIRALGKQGADVSELLAAVDPEQAIKLVRAFTAY
FT                   FNLANTAEQVHRGRELAATRAAEGSWLGQAVDRIQAAGLAGTAAEAVSHLSVRPVFTAH
FT                   PTEAARRTVLAKLRKVAELLEAPQTAYNERRLAETVEQLWQTDEIRITRPEPVDEARNA
FT                   VYYLDELAAHAAPEVLEELAVELRRLGVELPLSARPLSFGSWIGGDRDGNPNVTPQMTL
FT                   DVLELQHEHAIRTALASMDALREILSTSERIAAPTEALRASLDADLEALPEIPNRYRRL
FT                   NAEEPYRLKATTIRQKLLNTRTRIAEGRQHDPRRDYLGTSELLRDLSLMRDSLYADRGE
FT                   LIATGELETAIRTIAAFGLHHAVLDVREHADAHHHVLAQLFDRLGDQPWRYSDLPRDYR
FT                   TRLLAKELASSRPLSALGQVPADTLLDAAGVKSFGVFTAIRTAFEKYGPDVIESYIVSM
FT                   TRGVDDLFAAVVLAREAGLVDVHAHTAAIGFVPLLETPDELKIAGSILDEMLSDPSYAA
FT                   IVAARGGVQEVMLGYSDSNKMGGISTSQWEIHRAQRELRDTALRHGIRIRLFHGRGGSV
FT                   GRGGGPSHDAILAQPWGTLDGEIKVTEQGEVISDKYAIPALARENLELTLAATLEATVL
FT                   HRAPRQSAEDLATWSATMEGVSSAGQDRYRELVEHPDLPAYFFASTPVDLLGDLHLGSR
FT                   PSRRPDTSAGIDGLRAIPWVFGWTQSRQIVPGWFGVGTGLAAARQNPAFAGTDWQDMYE
FT                   RWHFFRNFLGNVSMTLAKTDLRIARHYVETLVPRELHHFFDTITEEYERTVAEVLRITG
FT                   ESELLGRNETLARTLRVRDMYLDPISYMQVSLLKRQREATKAGLPVDPDLARALLLSVN
FT                   GIAAGLKNTG"
     MSAVPSPKND DAAVETPTDS PTARANDTAN DNPPRTADDA ELRAAIRRLG DLLGQTLVRQ        60
     HGPELLEQVE AIRALGKQGA DVSELLAAVD PEQAIKLVRA FTAYFNLANT AEQVHRGREL       120
     AATRAAEGSW LGQAVDRIQA AGLAGTAAEA VSHLSVRPVF TAHPTEAARR TVLAKLRKVA       180
     ELLEAPQTAY NERRLAETVE QLWQTDEIRI TRPEPVDEAR NAVYYLDELA AHAAPEVLEE       240
     LAVELRRLGV ELPLSARPLS FGSWIGGDRD GNPNVTPQMT LDVLELQHEH AIRTALASMD       300
     ALREILSTSE RIAAPTEALR ASLDADLEAL PEIPNRYRRL NAEEPYRLKA TTIRQKLLNT       360
     RTRIAEGRQH DPRRDYLGTS ELLRDLSLMR DSLYADRGEL IATGELETAI RTIAAFGLHH       420
     AVLDVREHAD AHHHVLAQLF DRLGDQPWRY SDLPRDYRTR LLAKELASSR PLSALGQVPA       480
     DTLLDAAGVK SFGVFTAIRT AFEKYGPDVI ESYIVSMTRG VDDLFAAVVL AREAGLVDVH       540
     AHTAAIGFVP LLETPDELKI AGSILDEMLS DPSYAAIVAA RGGVQEVMLG YSDSNKMGGI       600
     STSQWEIHRA QRELRDTALR HGIRIRLFHG RGGSVGRGGG PSHDAILAQP WGTLDGEIKV       660
     TEQGEVISDK YAIPALAREN LELTLAATLE ATVLHRAPRQ SAEDLATWSA TMEGVSSAGQ       720
     DRYRELVEHP DLPAYFFAST PVDLLGDLHL GSRPSRRPDT SAGIDGLRAI PWVFGWTQSR       780
     QIVPGWFGVG TGLAAARQNP AFAGTDWQDM YERWHFFRNF LGNVSMTLAK TDLRIARHYV       840
     ETLVPRELHH FFDTITEEYE RTVAEVLRIT GESELLGRNE TLARTLRVRD MYLDPISYMQ       900
     VSLLKRQREA TKAGLPVDPD LARALLLSVN GIAAGLKNTG                             940
//

If you have problems or comments...

PBIL Back to PBIL home page