(data stored in ACNUC7421 zone)

EMBL: CP001700.PE179

CP001700.PE179       Location/Qualifiers
FT   CDS             192506..193534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0179"
FT                   /product="signal peptidase I"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24 and
FT                   S26 domain protein; KEGG: sgr:SGR_6861 putative signal
FT                   peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69134"
FT                   /db_xref="GOA:C7QHJ5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ5"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ACU69134.1"
FT                   /translation="MAATDPGAPVGSQPAEPPFGDGYGTTGNGYGQQHGFGTENGYGTE
FT                   NGYGAENGYGSAPGFASENGYSQDQGYASEHAFGTQNGYDPVAGDGSAATDPATDPDAA
FT                   DEELAAVPSRGGGRRAARTKAKRRRIPAWLEIVGYVVISLTLTSLIKTFLVQMYYIPSP
FT                   SMEPTTYKGDRVFVDKLSSWVGGAPARGQVIVFHDPHNWLMSSAGSTGGAINLPDVLAA
FT                   VGILPDQHDDLLIKRIIGTGGDTIECKTQDGPVYRNGVALDESSYIMNGKQGMPCYNGV
FT                   YKVTVPQGDLWVLGDNREHSGDSSWNYLKKGGDAGFVPTKNVVGHVVGVVSWLRDDHPA
FT                   GS"
     MAATDPGAPV GSQPAEPPFG DGYGTTGNGY GQQHGFGTEN GYGTENGYGA ENGYGSAPGF        60
     ASENGYSQDQ GYASEHAFGT QNGYDPVAGD GSAATDPATD PDAADEELAA VPSRGGGRRA       120
     ARTKAKRRRI PAWLEIVGYV VISLTLTSLI KTFLVQMYYI PSPSMEPTTY KGDRVFVDKL       180
     SSWVGGAPAR GQVIVFHDPH NWLMSSAGST GGAINLPDVL AAVGILPDQH DDLLIKRIIG       240
     TGGDTIECKT QDGPVYRNGV ALDESSYIMN GKQGMPCYNG VYKVTVPQGD LWVLGDNREH       300
     SGDSSWNYLK KGGDAGFVPT KNVVGHVVGV VSWLRDDHPA GS                          342
//

If you have problems or comments...

PBIL Back to PBIL home page